(data stored in SCRATCH zone)

EMBL: CP002059.PE309

CP002059.PE309       Location/Qualifiers
FT   CDS_pept        436551..437459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0426"
FT                   /product="protein of unknown function DUF422"
FT                   /note="PFAM: protein of unknown function DUF422; KEGG:
FT                   ana:all0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62977"
FT                   /db_xref="GOA:D7E068"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:D7E068"
FT                   /inference="protein motif:PFAM:PF04240"
FT                   /protein_id="ADI62977.1"
FT                   /translation="MKQLVIVERVCLIGHIVSMVFGLVGILLVIPNAELILSLSEVGQT
FT                   VMQWSMAGGGVAYMILGAVGVFLYAYRTLGLGRALCFLLPSVLISLTSELLGTSTGFPF
FT                   GNYSYLSGLGYKIAGLVPFTIPLSWFYVGCVSYLLARVGLEVDKKPSLFRHLGAIALGA
FT                   LLLTSWDFVLDPAMSQTSLPFWYWQQPGAFFGMPYQNFAGWMGTGSVFMTVAAVLWRNN
FT                   PVKLERAQLNIPLVVYLGNFGFATVMSLAAGFSIPVLLGLVLGVAPAVALWLRGPGAST
FT                   LVGVEPATKEVSVASVKVAFK"
     atgaaacaac tagttattgt tgagcgcgta tgcctgattg gtcatatcgt gtctatggtg        60
     tttggactag tagggatatt attagttatt cctaatgcgg aattaatttt gagcttatct       120
     gaagtcgggc agactgtcat gcagtggagt atggcaggtg ggggagtggc ttatatgatt       180
     ttaggtgcag taggtgtttt cctgtatgct taccggacat tgggtttagg tcgtgctttg       240
     tgtttcctgt tgccttctgt attaatttct ttgactagtg agttactagg aaccagcaca       300
     ggttttcctt ttggtaacta cagctatttg agtggcttgg gttataagat tgcgggttta       360
     gtgccgttta ccattccctt gtcatggttt tatgtgggat gcgtttccta cctgctggcg       420
     cgtgtagggt tagaggtaga taaaaagccc agtttgttcc gtcatctagg tgcaatcgcc       480
     cttggtgctt tattgctgac ttcttgggat tttgtccttg acccggctat gagtcaaact       540
     tctcttccct tctggtattg gcaacaacca ggtgctttct ttgggatgcc ttaccaaaac       600
     tttgccggtt ggatgggtac tggttcagtc tttatgacag tagcggcggt gttgtggaga       660
     aacaatccag taaaattaga gcgcgcacaa ctcaatattc ctttagttgt gtatttgggt       720
     aactttggtt ttgcaaccgt gatgagtttg gctgcgggct tctccattcc tgtattgcta       780
     ggtttggtac ttggcgttgc acctgctgta gcactgtggt tgagaggtcc tggcgcatcc       840
     actctcgtag gtgttgaacc tgcaaccaaa gaagtttccg ttgccagcgt caaagtcgct       900
     ttcaagtaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page