(data stored in SCRATCH zone)

EMBL: CP002059.PE31

CP002059.PE31        Location/Qualifiers
FT   CDS_pept        complement(38168..38716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0043"
FT                   /product="filament integrity protein"
FT                   /note="KEGG: ana:alr2392 filament integrity protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62699"
FT                   /db_xref="GOA:D7DVI7"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI7"
FT                   /inference="similar to AA sequence:KEGG:alr2392"
FT                   /protein_id="ADI62699.1"
FT                   /translation="MPEELSLPRILPIGAMLFETLFLLVAISIEGYVLHRWLKFDKKTS
FT                   IFYALAINVFSSVFGWNIFFLVEPRLDVKLKSELISYIFFNNFKNPGTQSTIIFLASLI
FT                   FLGTFLIKFLLLKVLIITLSEIGEKEKIETSQQQKLYRIEKMQLQNTNLITTTLIANSM
FT                   SYTAITLILLIRNLSIGLN"
     atgcctgaag aattgtcact tcccagaatt ttgcccatcg gtgcaatgtt gtttgaaact        60
     ttatttttac tagttgccat ttccatagaa gggtatgttt tgcatagatg gctaaaattt       120
     gacaaaaaaa ccagtatttt ttatgcccta gccataaacg ttttttctag cgtctttgga       180
     tggaatatat tttttctagt tgagccaaga ttagacgtta aattaaaatc agaattaata       240
     agctatatat tttttaataa ctttaagaat cctggaacac agagtaccat aatttttctg       300
     gcttctttaa tcttccttgg tacttttttg atcaagtttt tattactcaa agttctaatt       360
     attaccttaa gtgaaattgg ggaaaaagaa aaaattgaaa cctctcaaca acaaaaatta       420
     tacagaattg aaaaaatgca attgcaaaat actaacctaa ttactactac attaatagca       480
     aattctatga gctatacagc cataacttta attttactaa ttcgcaattt atctatagga       540
     ctaaactaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page