(data stored in SCRATCH zone)

EMBL: CP002059.PE313

CP002059.PE313       Location/Qualifiers
FT   CDS_pept        441427..442362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0431"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /note="KEGG: npu:Npun_F0596
FT                   1-aminocyclopropane-1-carboxylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62981"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7E072"
FT                   /inference="similar to AA sequence:KEGG:Npun_F0596"
FT                   /protein_id="ADI62981.1"
FT                   /translation="MSSIFLPPAIQKINSQIADSVGVKLYVLRLDLMHSQVNGNKWFKL
FT                   KYNLLSAKEKNVSTILTFGGAYSNHIFATAAAGNIFGFRTIGVIRGEETFPLNPTLSFA
FT                   VEQGMQLVYCNRTTYRQRHTTQLQEDLKQRFDEVFIIPEGGCNLNGMRGCTEIMQNLEL
FT                   FDTICLACGTATTLAGIAISLHLKQKIIGFPILKGGEFLAAEIESLINNYLTSDLPALV
FT                   NSPAPWELVCDYHFGGYAKVNQELIMFCQKFTQEHDIPLDYVYTGKMFYGVMNLLQQGF
FT                   FQPGRLLLIHTGVLQGNQGINEKLLRKVFK"
     atgtcgtcaa tctttcttcc tccagctata caaaaaatta atagtcaaat agctgatagt        60
     gttggtgtta aattatacgt actacgtctt gatctcatgc actcacaggt taatggtaat       120
     aagtggttca aattgaaata taacctgttg tcagctaagg agaaaaatgt atccactata       180
     ctcacttttg gcggtgctta ttctaaccat attttcgcca cagcagccgc aggtaatatt       240
     tttggttttc gtactattgg ggtgattcgt ggagaggaaa cttttcccct caatcctaca       300
     ttgagttttg cggtagaaca aggtatgcag ttagtatatt gcaatcgcac aacctatcga       360
     caacgccata caactcaact acaggaagac ttaaaacaac ggtttgatga agtatttatc       420
     attcccgaag gtggttgtaa cctcaatgga atgcggggtt gtacagaaat aatgcaaaat       480
     ttagaactat ttgatactat ttgtctagcc tgtggaacag ccacaacatt agctggtatt       540
     gccatatcat tacatttgaa acagaaaata attggctttc ctatattaaa aggtggagaa       600
     tttctagcag cagaaataga gagtttaatt aacaattatc tcacatctga tttacctgca       660
     ctagttaatt ctcctgcacc ttgggaatta gtatgtgact atcatttcgg aggttatgca       720
     aaggtaaatc aggaattaat tatgttttgc caaaaattta cccaagaaca cgacataccc       780
     ctagattacg tatatacggg aaaaatgttt tatggagtca tgaatttact acaacaggga       840
     ttttttcaac caggtcgtct actattaata catacaggcg ttttacaggg aaatcagggc       900
     attaacgaga aattacttag gaaagtattt aagtaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page