(data stored in SCRATCH zone)

EMBL: CP002059.PE320

CP002059.PE320       Location/Qualifiers
FT   CDS_pept        complement(463214..464884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0449"
FT                   /product="L-aspartate oxidase"
FT                   /note="KEGG: npu:Npun_F4510 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62988"
FT                   /db_xref="GOA:D7E079"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D7E079"
FT                   /inference="protein motif:TFAM:TIGR00551"
FT                   /protein_id="ADI62988.1"
FT                   /translation="MNLLDIPRQFDVLIVGAGAAGLYTALCLPESLRVGLITKDTITLS
FT                   ASDWAQGGIAAAVSPEDSPKLHIADTLKAGAGLCDVKAVKFLAEKAPICIQSLVNLGVA
FT                   FDRHGNTLALTLEAAHSRHRVLHAADTTGREVTTTLAAQVLLRPNIQVIQQALALSLWI
FT                   EPETNLCQGISLFYQGKVTWVKADAVVLATGGGGQVFAQTTNPAVSTGDGVAIAWRAGA
FT                   ILRDLEFVQFHPTALTKPGRFLISEAVRGEGAHLVDNEGRRFAFDYHPDGELAPRDVVS
FT                   RAIFSHLQDTAVDLATAHVWLDMRPIPADKIRHRFPNIINVCQHWGIDVFNEPIPVGPA
FT                   AHYWMGGIFTDLHNRTNIPGLYAVGETASTGVHGANRLASNSLLECIVFGAQMAHFQDE
FT                   MLRKGQTTESPSSPNPLSFELSVSDWENQQLQLEAIRKKLPRLVWQTAGICREQSSLEN
FT                   AIATIESWQQDFANLPLSKFLQRLRPQEPASFNLPNIDQQLRLWAETHNLLDVAYLILK
FT                   SAAFRTESRGGHYRLDYPQLAPEWQVHTTIQNHHWWQSN"
     ttgaatttat tagatattcc caggcaattt gatgttttaa tagtcggcgc tggcgctgct        60
     ggactataca cagcactatg tctaccagaa tccttacgag taggcttaat tactaaagac       120
     actataactt tatctgccag tgattgggcg caaggtggta ttgctgctgc tgtttctcca       180
     gaggattcac ccaagctgca tattgcagat acattaaaag ccggagcggg tttgtgtgat       240
     gtcaaagcgg taaaattttt agctgaaaaa gcccctattt gtattcagtc cttagttaac       300
     ttaggggtag cctttgaccg tcatggtaac accttggctt taaccttgga agctgctcat       360
     tcccgtcatc gtgttcttca cgccgccgat accacaggta gagaagtaac cacaactctc       420
     gcggctcaag tcttgcttcg tcccaatatc caagttattc agcaagcttt agctttatcc       480
     ttatggatag aaccagaaac caatctttgt caaggaatta gcctgtttta tcaaggtaag       540
     gttacatggg taaaggctga cgctgtagtt ttggcaacag gtggtggagg tcaagtattt       600
     gcccaaacta ctaatccggc tgtaagtaca ggtgatggcg tagctatagc ttggcgggct       660
     ggggctatcc tccgcgattt agaatttgtc caatttcatc ctacagcctt gacaaaacca       720
     ggacgctttc tgatcagcga agctgtacgc ggtgaaggag cgcaccttgt tgataacgaa       780
     ggacgacgtt ttgcttttga ctatcatcca gatggggaac ttgcaccgcg agatgtggtc       840
     agtagagcta tttttagtca tttacaagat acagccgttg atcttgccac tgcccatgtc       900
     tggttagata tgcgtcctat ccctgctgat aaaattcgcc atcggtttcc taacattatt       960
     aatgtttgtc agcattgggg tattgatgtc ttcaatgaac cgattcctgt aggtccggct      1020
     gctcactatt ggatgggtgg tattttcaca gatttgcaca atcgtaccaa tatccctggt      1080
     ttatacgctg tgggagaaac tgccagtacg ggagttcatg gcgctaatcg cctcgccagt      1140
     aattctctat tggaatgtat agtctttggg gcgcagatgg ctcatttcca ggatgaaatg      1200
     ctgagaaagg gacaaactac agaatctcca tcttccccaa atcctttatc ttttgagtta      1260
     tccgttagtg attgggaaaa tcaacaatta caactagaag caatcaggaa aaagttaccc      1320
     cgtttagtct ggcaaactgc tggtatttgt cgagaacaat caagtttgga aaatgcgatc      1380
     gctactatag aatcttggca acaagatttc gctaatttac ctttaagtaa atttttacaa      1440
     cgtttacgtc ctcaagaacc agcaagtttc aatttaccga atattgatca gcaattgcga      1500
     ctttgggcag aaacccacaa tttattagat gtagcttatt taattctcaa aagtgctgct      1560
     tttagaactg aaagcagggg gggacactac cgtttagatt atccccaact agctcctgag      1620
     tggcaagtcc acacaactat ccaaaatcat cattggtggc aatctaacta a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page