(data stored in SCRATCH zone)

EMBL: CP002059.PE348

CP002059.PE348       Location/Qualifiers
FT   CDS_pept        complement(513051..513329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63016"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63016.1"
FT                   /translation="MITILDLGLNNLKLKILPAVPLVLQYQSKIKMAGDRREESRLNQL
FT                   FGLIRFFHFIYFDICENILGLALKNSLHPCLSTFLPTQAIKNHIKLL"
     atgattacga ttttagattt gggattaaac aatctaaaac ttaaaatatt acctgccgtg        60
     cctctggttc tccaatacca atccaaaatt aaaatggcag gagacagaag agaagaaagt       120
     aggctgaatc agctttttgg gcttattaga ttctttcact tcatatattt tgatatttgt       180
     gaaaatatcc tgggccttgc actgaaaaac tccctacacc cctgcctctc tactttcctg       240
     cccacgcaag ctatcaaaaa tcacatcaaa ttgctataa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page