(data stored in SCRATCH zone)

EMBL: CP002059.PE366

CP002059.PE366       Location/Qualifiers
FT   CDS_pept        complement(534381..536645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0518"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cac:CAC2172 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63034"
FT                   /db_xref="GOA:D7E0C5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADI63034.1"
FT                   /translation="MKITKLAIIIVTWNKMNQVCLLLKDLNKLELPDINIDIYVVDNAS
FT                   TDGTQSYIEKYYSDQVKVLQTGSNLGGSGGFSCGLQFVSKLDYNYIWLLDDDIRLDSLA
FT                   LIPLINTLQNYEEVGVVGSQIRKLQKPNAIQEIGSFINNKKAHLKVNFGNQVNISTEDI
FT                   LQGKPYVNVDICAAASLLVRCKIVQNMGVFEDYFLHFDDVEWCLRVKQAGWVIAVNPHS
FT                   IVWHDSPDFKSRPWMNYYDERNLCYCWQKHRPELLLKRVVVSFPRLVYYAATGRYFLAE
FT                   ISIAGFQDFINGVQGKMLRKINYTEYPLGEIIHEPAKVFVQSSIYQDEFQSQNLKKIEV
FT                   DEKVTFWPLPNKFSRIWLWIIAWFWKPIDIAIVTYQHPTLDVLNLAKWVYYFTGNGYVP
FT                   VVINPLVLTKAVMKTSNEMWQIYWQIRKLKLSSIPEIMPTPLSPLVSIILCTSNRPNCL
FT                   EKALQSLELIHYQNFEVIVIDASSTNQTIEMVNQVSSKNNLKINFLQVEPKNISYSRNM
FT                   GIKLATGSIVAFFDDDAIPPSEWIEKLLDIYAIHDEKCAAVGGTVRDLTRPGYPLQFHR
FT                   GITNLFSETIAIRSADATNYNQANGLWFNGLMGTNCSFRKDILEKINGYDEFFDYFLDE
FT                   TDVCLRLIQAGYEVHYADVVIDHYPQPSHNRIDQKHLTCWYSLAKNTTYFAIKHGLTRG
FT                   LFPIFVTRLLLLITYRCWLRIIRLKFTHHIPNSVLIKYIQQTIEGIRVGWKSGMNLHQV
FT                   N"
     atgaagatta ccaaacttgc tatcattatt gttacatgga ataaaatgaa ccaggtttgt        60
     ctacttctaa aagaccttaa taaactagaa ctaccagata ttaatattga tatctatgtt       120
     gtagataatg catcaacaga tggtactcaa tcttacatag aaaaatatta ttctgatcaa       180
     gttaaggttt tacaaactgg tagtaattta ggtggttctg gaggattttc ctgcggacta       240
     cagtttgtta gtaaacttga ttacaattat atttggctac ttgatgatga tattcgtcta       300
     gattctctag cactaatacc attaattaat acattacaga attatgaaga agttggcgta       360
     gtaggttcac aaattcggaa gctacagaaa cccaatgcta ttcaggaaat tggtagcttt       420
     attaacaata aaaaagccca cttaaaagtc aactttggca atcaagtaaa tatatccaca       480
     gaagatattc ttcaaggtaa accctacgtt aatgtagata tctgtgcagc agcctcacta       540
     ttagtgcggt gtaaaattgt acaaaatatg ggagtatttg aagattactt tttacacttt       600
     gatgatgtgg aatggtgttt acgagtcaaa caagctggat gggttattgc ggtaaatcca       660
     cattcaatag tttggcacga ttctcctgat ttcaaatcta gaccttggat gaattattat       720
     gatgagcgta atctttgtta ctgttggcaa aaacatcgac cagaactttt attaaaaaga       780
     gtggttgtga gttttccccg actagtttat tacgctgcta caggaagata ctttctagct       840
     gaaatttcta ttgcaggttt tcaagacttt atcaatggtg ttcagggaaa gatgctcaga       900
     aaaattaatt atactgagta tcctttagga gagattattc atgagccagc taaagttttt       960
     gtgcaatcta gtatctatca agacgagttt caaagtcaga acctcaaaaa gatagaagtt      1020
     gatgaaaaag ttactttttg gcctttacct aataaattca gtcgcatttg gttatggata      1080
     attgcttggt tttggaaacc aattgatatt gccattgtta cttatcaaca tccgactctt      1140
     gacgttctca atctcgcaaa atgggtttac tactttacag gtaatggtta tgtgcctgtt      1200
     gtcattaatc cgttagtttt gacaaaggca gttatgaaga ctagtaacga aatgtggcag      1260
     atatactggc aaattcgcaa gctgaagtta tcgtcaatac cagaaatcat gcctactccc      1320
     ttatctcctc tagtttcaat catactttgt acaagtaatc gccccaattg tttagaaaag      1380
     gctttgcaat cactagaact aattcactat caaaactttg aagttattgt gattgatgct      1440
     tcatcaacaa atcaaacaat tgaaatggtc aatcaagtgt ctagcaaaaa taatttgaag      1500
     ataaattttc tacaagttga accaaaaaac atcagttatt cccgaaatat gggcatcaaa      1560
     ttagcaacag gttcaattgt ggcatttttc gatgatgatg ccattccacc gtctgaatgg      1620
     attgagaagt tactagatat ttacgccata catgatgaaa aatgtgcagc agttggaggt      1680
     acagtgcgtg atttaactcg tcctggttat cccctacaat tccaccgggg aatcaccaat      1740
     cttttcagcg aaactattgc tattcgttct gctgatgcta caaactataa ccaagcaaat      1800
     ggcttatggt ttaacgggtt aatgggaact aattgttctt ttcgcaaaga cattttggaa      1860
     aagattaatg gctatgatga attttttgac tactttctcg atgaaacaga tgtttgttta      1920
     cgtttaattc aagcaggata tgaagttcac tatgctgatg tagtaataga tcattatccc      1980
     caacctagcc acaatcggat tgatcaaaaa catctcacct gttggtattc cttagcaaaa      2040
     aatacaactt actttgctat caagcatgga ttaacaagag gtttatttcc tatattcgtt      2100
     acccgtttgc ttttactcat tacctatcgt tgttggttga gaattatccg tctgaaattc      2160
     acccatcata ttcctaactc agttttaata aagtatattc aacaaaccat tgaaggaatt      2220
     cgggttggtt ggaaaagcgg tatgaacctg catcaagtta attaa                      2265
//

If you have problems or comments...

PBIL Back to PBIL home page