(data stored in SCRATCH zone)

EMBL: CP002059.PE368

CP002059.PE368       Location/Qualifiers
FT   CDS_pept        complement(543613..544146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0524"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   npu:Npun_F2720 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63036"
FT                   /db_xref="GOA:D7E0C7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C7"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADI63036.1"
FT                   /translation="MPMWIRSALIRGSGTFCTGIVLMLMAWFSWSLPTSNLKTTTANAY
FT                   TLKQSITDSKNHQISQSRWIEIDLSEQRLRAWEGKTVVYSYRISTGKSRTPTPVGRFQI
FT                   NSKYPTHQMRGPGYDIPDVPYTMYFYQGYAIHGAYWHNRFGTPVSHGCVNLPVSQARRL
FT                   YNWSGMGTVVVVRR"
     atgccaatgt ggattcgcag tgctttaata cgtggctctg gaactttttg tacaggtata        60
     gtattgatgc tgatggcttg gttttcttgg tcattaccaa ccagtaacct taaaactact       120
     acagctaacg cttatacttt aaaacaaagt attactgatt ctaaaaatca tcaaatatcc       180
     caatctcgct ggattgaaat tgatttatct gagcagagat tacgggcctg ggaaggtaaa       240
     acagtggttt attcttaccg aatttctacg ggtaagagca gaactccgac acctgttggt       300
     agatttcaaa ttaattctaa atatcctact catcagatgc gtggtccagg ctacgacatt       360
     cctgatgttc cttataccat gtatttttat caaggctatg ccattcatgg agcttattgg       420
     cacaatcgtt ttggtactcc agtgagtcat ggttgcgtta atttgccagt tagtcaagcg       480
     cgtaggttat acaattggtc gggaatgggt actgtcgtgg ttgtgcgtcg gtag             534
//

If you have problems or comments...

PBIL Back to PBIL home page