(data stored in SCRATCH zone)

EMBL: CP002059.PE372

CP002059.PE372       Location/Qualifiers
FT   CDS_pept        550640..553249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0531"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: ana:all0860 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63040"
FT                   /db_xref="GOA:D7E0D1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D1"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADI63040.1"
FT                   /translation="MTTSQERIIPTDLRQEMSQSYLEYAMSVIVGRALPDARDGLKPVH
FT                   RRILYAMHELGLLPDRPFRKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMRSPLIN
FT                   GHGNFGSVDNDPPAAMRYTECRLQALTSASLLQDIESETVDFADNFDGSQQEPTVLPSR
FT                   IPQLLLNGSSGIAVGMATNIPPHNLGELIDGLVALIHNLEITNMQLMQYVHGPDFPTGA
FT                   QILGTSAIKEAYTTGRGSVTMRGVATIETIEQRNRPEREAIIITELPYQTNKAALIEKI
FT                   AELVNDKKIEGIADIRDESDRDGMRIVIELKRDAYPRVVLNNLYKQTPLQSNFGANMLA
FT                   LVNGEPQLLTLKNFLSVFLDFRIATINRRTCYQLRKAEERDHILQGLLIALSHLDAIIN
FT                   RIRSASDAPSAKGELITNYGLSEVQADAILQMQLRRLTALEADKIRLEHEELQVQIADL
FT                   QDILDRRERVLEIIETEVTQIKTQFATPRRTIITHAEGDIDDIDLIANEKVLILLTKQG
FT                   YIKRMPVNTFEAQSRATRGKAGAKVKDDDTIEHFLTCCDHDSVLFFSDRGVVYSLRTYQ
FT                   IPIGSRTSRGTPIVQMLPIPKEEKITSIVPVDEFTSEEYLVMLTKGGNIKKTALEAFSN
FT                   IRANGLIAISLEEGDQLRWVRRAKVEDSIIIGSRHGMAIHFRCTHDQLRPLGRATRGVK
FT                   SMKLKPGDELVGMDILPAAILETLDTETEAEIEEETIDIEETTEIEEISETTEAPNSNS
FT                   TGPWVLVITMGGYGKRVPVGQFRLQNRAGQGLTATKFKNRKTKDKLATLRIVNSDEEIM
FT                   MATNRGIIIRQTVNAISVQSRSATGVRVQRLDEDDAITGVAIVPPDTGDTGELEEVE"
     atgacaacct cacaggagag gattatcccg acagatttac gacaagaaat gtcgcaatct        60
     tatctggaat acgccatgag cgtaattgta ggtcgggcgc tgccagatgc cagggatggt       120
     ctaaaacctg tgcatcgtcg catcctctat gccatgcacg agttgggttt gctgccggat       180
     cgccctttta gaaaatgcgc ccgtgtggtg ggggaagtgt tgggtaaata tcacccccac       240
     ggtgacacgg cggtatatga tgctttggta cggatggcgc aggatttttc catgcgatcg       300
     cccttaatta acggtcatgg taacttcggt tctgtggaca acgatccccc agcggcgatg       360
     cggtacacag aatgtcgttt acaagcttta accagcgcgt ccttactgca agacatcgaa       420
     tcagaaaccg tagactttgc tgataacttc gacggttccc aacaagaacc cacggtttta       480
     ccatcacgca tcccccaatt attactcaat ggttcttctg gaattgcggt cggcatggct       540
     accaacattc ctccgcataa tttgggagaa ttgattgatg ggttagtagc attgattcac       600
     aacctagaaa tcaccaacat gcagttaatg cagtatgttc acggtccaga cttccccact       660
     ggggcgcaaa ttctgggaac atcggcaatt aaagaggcat acaccactgg gcgcggttct       720
     gttaccatgc gcggtgtggc taccattgaa acgatagaac aacggaatag accggaacgg       780
     gaggcaatta ttattacaga attgccttat caaaccaaca aagcagcatt aattgaaaaa       840
     atcgccgagt tggtgaatga taaaaaaatt gagggcatag cagatattcg ggatgaaagt       900
     gatcgcgacg gaatgcgaat cgtcatagaa ttaaaacggg atgcctatcc gcgcgtggtt       960
     ttaaataacc tttataaaca aaccccactc cagtcgaact ttggcgcgaa tatgttggcc      1020
     ttggtcaatg gggaacccca attactcact cttaaaaact tcctcagcgt cttcctggat      1080
     ttccgcattg caaccattaa cagacgtacc tgttaccaac tcagaaaagc agaagaaaga      1140
     gatcatatac tgcaaggttt attaattgca ctatcacatt tagacgcaat tattaaccga      1200
     attcgtagcg cctcagatgc accctcagcc aaaggtgaat taatcaccaa ttatggactt      1260
     tccgaagtcc aagccgatgc cattttgcaa atgcaactgc gacggttaac agccctagaa      1320
     gcagataaaa ttcgcctgga acacgaagaa ttacaggtgc aaattgccga cttgcaggat      1380
     attttggaca gacgggaaag ggtcctggaa atcattgaaa ccgaagttac ccaaatcaaa      1440
     acccaatttg ctaccccccg acggacaatt attacccacg cagaagggga tatagatgat      1500
     attgacttaa tagccaatga aaaagtcctg attctgctga caaaacaagg ttacatcaag      1560
     cggatgcccg tcaacacctt tgaagcccaa agtcgtgcta ccagaggtaa agctggggct      1620
     aaggtgaaag atgatgatac cattgaacat ttcttaacct gctgtgacca tgacagcgta      1680
     ttatttttta gcgatcgggg cgtagtctac agcctcagaa cctatcaaat acctataggt      1740
     tcccgcacca gtcggggtac acccatcgtc cagatgttac ccattcccaa agaagaaaaa      1800
     attacctcta tcgtccccgt agacgaattt accagcgaag aatatctagt catgctcacc      1860
     aaaggcggta acatcaaaaa aactgcacta gaagcattta gcaacattcg cgctaacgga      1920
     ttaatcgcca tatccttaga agaaggtgac caactgcgct gggtaagacg cgccaaagta      1980
     gaagatagta tcatcattgg ttcacgtcac ggaatggcca ttcacttccg ttgtacccat      2040
     gatcaactgc gtccccttgg tagggcgact cgtggggtaa aatcaatgaa actcaagcca      2100
     ggtgatgaac tggtagggat ggatattcta cctgccgcaa ttctggaaac tttagataca      2160
     gagacagaag cggaaatcga agaagaaact attgacattg aagagaccac cgaaatcgaa      2220
     gaaatttcag aaaccactga agcacccaac agcaacagca caggaccttg ggtattggta      2280
     attacgatgg gaggatatgg aaagcgcgta ccagtgggac aattccgcct acaaaaccgc      2340
     gccggacaag gtttaaccgc caccaaattc aaaaaccgca aaaccaaaga caaactagca      2400
     accttgcgaa ttgtcaacag cgacgaagaa attatgatgg cgacaaatcg cggtattatt      2460
     attcggcaaa cggtcaatgc aatttccgta caatcacggt cagcaaccgg agttagagta      2520
     cagcgtttag acgaagatga tgctattacc ggagtagcga tcgttcctcc cgacactggt      2580
     gatactggcg aattagaaga ggttgaataa                                       2610
//

If you have problems or comments...

PBIL Back to PBIL home page