(data stored in SCRATCH zone)

EMBL: CP002059.PE376

CP002059.PE376       Location/Qualifiers
FT   CDS_pept        557098..557235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63044"
FT                   /db_xref="GOA:D7E0D5"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63044.1"
FT                   /translation="MTTYIFFDEALRMLTNAYLISAIILIAASSIGLAVIETIGKTGEH
FT                   "
     atgaccacct acattttttt tgacgaagcc ctccgaatgc tgaccaatgc ctatttgatt        60
     tcagcaatca tattaattgc agcttccagt ataggtttgg cagttattga gacaattgga       120
     aaaacgggag aacactaa                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page