(data stored in SCRATCH zone)

EMBL: CP002059.PE387

CP002059.PE387       Location/Qualifiers
FT   CDS_pept        578579..578833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0555"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: ana:alr1018 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63055"
FT                   /db_xref="GOA:D7E0E6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR014087"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E6"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADI63055.1"
FT                   /translation="MNDAVSVAKNILSGKVSAVEVTQAALSKIPTKDNELNCFTDIAVE
FT                   TALQDAAHIDQNIAKGKSPRVLAGVPFAVKNSFNKYNRT"
     atgaatgatg ctgtatctgt agctaaaaat atattatcag gtaaagtcag tgcagtagaa        60
     gttactcaag ctgcgttatc gaaaattcct actaaagata atgaacttaa ttgttttact       120
     gatatcgctg tggagacagc tttacaagat gcagcacata ttgatcaaaa tatcgctaaa       180
     ggtaaaagtc ctcgtgtatt agctggtgta ccttttgcag taaaaaattc atttaataaa       240
     tataatagga cttag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page