(data stored in SCRATCH zone)

EMBL: CP002059.PE388

CP002059.PE388       Location/Qualifiers
FT   CDS_pept        complement(581289..581951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R1092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63056"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E7"
FT                   /inference="similar to AA sequence:KEGG:Npun_R1092"
FT                   /protein_id="ADI63056.1"
FT                   /translation="MLFPDLNELDLRYRSQAKARPQVVVSIATAFNMSDHNYQKISDFI
FT                   QSVERLYPTLQGTAPVGQIDLQINPIEYHLVHLIGWQLLNLEQQQLDTCNEYLQTGGVI
FT                   LIEVPTNGSILTEDIKNLIAYHFEIPLQSWQELSRNHPLRTKPFLFAGLPHIDEELLRI
FT                   SNAGGIILVEGELSAAWGLDDNLTLDRNDIRTAQELGIDFLHFALQRRQMTQLIIHN"
     ttgttattcc ctgatcttaa cgagttggat ttgcgctatc gttctcaggc taaagccaga        60
     ccacaggtgg tagtgagtat tgctactgct ttcaatatga gcgatcacaa ctatcagaaa       120
     atttccgatt ttatccaatc tgtagaaaga ctttatccaa ctttacaggg aacagcacca       180
     gttggacaga tagatttaca aataaacccc atagaatatc acttagtaca tctcattggt       240
     tggcagctat taaatctaga acaacaacaa ctagatactt gcaatgaata cttacaaaca       300
     ggtggcgtaa ttctcattga agttcccacc aatggttcta tcttaacaga agatatcaaa       360
     aatctaattg cataccactt tgagattccc ttacaatctt ggcaggaact gagccgtaat       420
     catcccttaa gaacaaaacc ttttttattc gcaggacttc cccacataga tgaagaactt       480
     cttcgcattt caaatgcagg aggaattatt ttggtagaag gtgaattatc agcagcgtgg       540
     ggattagatg ataatttgac acttgatcgc aatgatattc gcacagccca agaattaggc       600
     attgattttc tccattttgc cctgcaacgc cgacaaatga cacagttaat aattcataat       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page