(data stored in SCRATCH zone)

EMBL: CP002059.PE39

CP002059.PE39        Location/Qualifiers
FT   CDS_pept        complement(47796..47918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62707"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62707.1"
FT                   /translation="MTAFGYNVRENALESLNFSGLRPQVFFDLISSQIDSNSKP"
     atgacagcat ttggttacaa tgtgagagag aatgctttag aaagcttaaa cttttctggc        60
     ttacgccccc aagttttttt tgatttgatt tcctcacaga tagatagtaa ctcaaagcca       120
     tga                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page