(data stored in SCRATCH zone)

EMBL: CP002059.PE394

CP002059.PE394       Location/Qualifiers
FT   CDS_pept        complement(593557..594510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0566"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="KEGG: ava:Ava_1163 NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase-like; PFAM:
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63062"
FT                   /db_xref="GOA:D7E0F3"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F3"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ADI63062.1"
FT                   /translation="MTYRKSKIENRKTVVILGAGAWGTALANLAWVNGHEVRLWSRNSS
FT                   QTLAAVLQDAADIVLSAISMKGVRDVALLVKSCPLSPEIIFVTATKGLDPQTTYTPSQT
FT                   WQTEFPHHSVVVLSGPNLSQEIEQELPAACVVASKNFAAAHQVQLVFSSSRFRVYTSPD
FT                   PIGVELGGTVKNVMAIAAGVCDGLHLGTNAKAALVTRALTEMVRIGQVLGSKTETFYGL
FT                   SGLGDLLATCNSPLSRNYQVGYQLASGKRLTEILNTLPGTAEGVNTCRVLMQISQQQNI
FT                   TIPITEQVYRLLESEVTPQQALDELMLRDMKPEYNQ"
     atgacttatc gaaaatcgaa aatcgaaaat cgaaaaactg ttgtgattct gggtgctggt        60
     gcctggggaa cagccctggc aaatttagcg tgggtaaatg gtcatgaagt gcgtttgtgg       120
     tcccgtaaca gttcccagac gctggcagca gtactacaag atgctgctga tatagttcta       180
     tctgctattt ctatgaaagg agtgagggat gtagctttat tagtaaagtc ttgtccatta       240
     tctccagaga taatttttgt cacagcaaca aaagggttag atccgcaaac tacttacaca       300
     ccttcacaaa cttggcaaac agaatttcct caccactcag tagttgtact atctggtcca       360
     aatttatccc aagagattga acaggaacta cccgctgcat gtgtagtagc cagcaaaaat       420
     tttgctgcgg ctcatcaggt gcaactggta ttttcttcca gtcgtttccg tgtttatacc       480
     agtcctgatc caattggtgt agaattggga ggaacagtga aaaatgtgat ggcaatcgca       540
     gcgggtgtct gtgatggact gcacttagga actaatgcca aagcagcttt agtaactcgc       600
     gctttgacag aaatggttcg gataggtcaa gttttaggct caaaaacgga aacattttac       660
     ggtttatccg gtctagggga tttgttagca acctgcaaca gtcccctaag tcgcaactac       720
     caagttggat atcaactggc tagtgggaaa aggctgacag aaatactcaa tactttacca       780
     ggaaccgctg aaggagttaa cacttgccga gttttgatgc aaatatctca gcaacaaaat       840
     attactatac caatcactga acaagtttat cggttactgg agagtgaagt tacacctcaa       900
     caagcccttg atgaactaat gttaagagat atgaagccgg aatacaacca atag             954
//

If you have problems or comments...

PBIL Back to PBIL home page