(data stored in SCRATCH zone)

EMBL: CP002059.PE401

CP002059.PE401       Location/Qualifiers
FT   CDS_pept        603221..603565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63069"
FT                   /db_xref="InterPro:IPR008479"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U0"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5796"
FT                   /protein_id="ADI63069.1"
FT                   /translation="MSNQPNRVSEFFDSESETSNLWHYVKSLSPETVTQLSKPNSPEVF
FT                   HVMERNITGLLGNLPSEHFGVTITTNRENLGRLLASAMISGYFLRNAEQRMSFNMSLQE
FT                   TEANSSDVAE"
     gtgagtaacc aaccgaatcg agtctctgag ttttttgata gcgagtctga aactagcaac        60
     ttatggcatt acgttaaatc cttaagtcca gaaacagtta cccagctatc caaaccaaat       120
     tctcccgaag tctttcacgt gatggaacgc aatatcacag gactattagg aaacttacct       180
     tctgaacact tcggtgtgac tataactacg aatagggaaa atttgggacg gttactggca       240
     tctgctatga ttagtggtta ttttttgcgt aatgctgaac agcgaatgag ctttaacatg       300
     agcttgcaag aaactgaagc aaatagcagt gatgttgctg aatag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page