(data stored in SCRATCH zone)

EMBL: CP002059.PE405

CP002059.PE405       Location/Qualifiers
FT   CDS_pept        605596..606252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0577"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; HEAT domain containing protein;
FT                   KEGG: ana:alr3814 phycocyanin alpha phycocyanobilin lyase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63073"
FT                   /db_xref="GOA:D7E0U4"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U4"
FT                   /inference="protein motif:PFAM:PF03130"
FT                   /protein_id="ADI63073.1"
FT                   /translation="MSASAESVRELLSSENLGDRLRAVNQIRELEPNTGFELVQIAIGD
FT                   KNSRVRYSAVSQLDTLGEQDFDLSLRILRELLNDPEADVQAAAADCLGALKLHAAFEDL
FT                   EQLYHTTSEWLVQFSIIATLGAFGDPRSLELLKQALNSDNSLIQTAAISSLGELGDVQA
FT                   VSLLIPYSTNPDWQVRYIVVQALSNLGGAEAQSILETLVNDEVDAIRQEAKQALE"
     atgagtgctt ctgctgaatc tgtgagagaa ttactgagtt cggagaattt gggcgatcgc        60
     ttgcgtgcag tcaatcaaat tcgagaacta gaaccaaaca ctgggtttga attggttcaa       120
     atcgctattg gtgataaaaa ttcccgtgtt cgctattcgg cggtaagtca acttgatacc       180
     ctgggagagc aggatttcga tttatctttg cggatattac gcgaactgct caatgatcct       240
     gaagcggatg tgcaagcagc agcagcagat tgtttaggtg cgcttaaatt acacgcagct       300
     tttgaagatt tagagcaact ttaccataca acctcggaat ggctagtaca attcagtatt       360
     attgctacat taggagcatt tggtgatccg cgcagtttgg aacttctcaa acaagctctt       420
     aactcagata acagtttaat ccaaactgct gctatcagtt ctctaggtga gttaggagat       480
     gtccaagcag tttctctatt gattccatac agcactaacc cagattggca agtgcgttac       540
     atagttgtcc aagctttaag caatttaggt ggtgcggaag ctcaatctat tctggagaca       600
     ctggttaatg atgaagtaga tgcgatcaga caagaagcga aacaagcttt ggaatag          657
//

If you have problems or comments...

PBIL Back to PBIL home page