(data stored in SCRATCH zone)

EMBL: CP002059.PE42

CP002059.PE42        Location/Qualifiers
FT   CDS_pept        49341..49895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0056"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   ava:Ava_0520 WD-40-like beta propeller repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62710"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD5"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ADI62710.1"
FT                   /translation="MKTFTFTLWLQRRIHWSLVFSLTGLLMSCGSGDIPLGVSSLNSRF
FT                   TEEQPALSGNGRFLAFVSNRNGNQQLLMYDLQTQSFIPTPGLNRRATIAESPSLSYTGR
FT                   YICYLTSEQGRPVIALYDRAMQQSQILTPTYRGWVRNPDISPDGRYVVFESASRGQWDV
FT                   EVLDRGPTVELDISNGSTVSN"
     gtgaaaacat ttacttttac attgtggctc caaagacgca ttcattggag ccttgttttt        60
     agtttgactg gtttacttat gtcttgtggt tctggtgata ttcctcttgg ggtctcttcg       120
     ctcaatagtc gttttactga ggaacaacct gctttaagtg gaaatggtcg ctttttggcg       180
     tttgtttcta atcgaaatgg taatcagcaa ttattgatgt acgatttgca aacgcaaagt       240
     tttattccca caccaggttt aaatcgtcga gcaactattg ctgaaagccc tagtttgagc       300
     tatacaggtc gttatatttg ttatttaact agcgagcaag gtagaccagt gatagctctt       360
     tacgatcgcg ctatgcaaca atcacaaatc cttactccta cctatcgcgg ttgggtgaga       420
     aatcctgata tcagtcctga tggacgttat gttgtgtttg aatctgctag tcgtggacaa       480
     tgggatgttg aagttttaga cagaggtccg actgtagagt tagatatttc caatggttca       540
     actgtgagta attaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page