(data stored in SCRATCH zone)

EMBL: CP002059.PE427

CP002059.PE427       Location/Qualifiers
FT   CDS_pept        complement(641905..642450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63095"
FT                   /db_xref="GOA:D7E0W6"
FT                   /db_xref="InterPro:IPR021275"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W6"
FT                   /inference="similar to AA sequence:KEGG:Ava_3168"
FT                   /protein_id="ADI63095.1"
FT                   /translation="MLGKISLGTLGLTVGGILIIVGFIAYAVENATLNLVGFFYGFPLF
FT                   LGGLALKANELKPIPFSQRTTPSILDLRKQQATVTQNKIRTDITRFCYGQEAHLDRALA
FT                   YLGLSPSDEKRPIVTGLRETELNGAYSLILEFDSPLIPIDIWQQKHAKMTKYFAPNVEV
FT                   KITQPAENRIELELIKTQ"
     atgctaggca agatttcttt gggaacactc ggtttaactg tcggtggcat attaatcata        60
     gtcggtttta tcgcctatgc tgtggagaac gctactctca acctcgtggg atttttctat       120
     ggctttcctc ttttcttggg aggtttagca ctcaaggcca atgaactcaa gcctataccc       180
     tttagtcaaa ggaccacacc atcaatattg gatctcagaa aacagcaagc gactgtaact       240
     caaaacaaaa tccgcacgga cattacacgc ttttgctatg gtcaggaagc acatttagat       300
     cgggcgcttg cttatctggg tttgagtcct agcgatgaaa aaagacccat agtaactggg       360
     ttaagagaaa cagaacttaa tggtgcttat tccttaattt tagaatttga ttcccctcta       420
     attcccatag atatttggca gcaaaaacat gcaaaaatga ctaaatattt tgctcctaat       480
     gttgaagtaa aaattacaca gcccgctgaa aatagaattg aactggagtt aattaaaact       540
     caatag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page