(data stored in SCRATCH zone)

EMBL: CP002059.PE436

CP002059.PE436       Location/Qualifiers
FT   CDS_pept        complement(657296..657679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:657521..657523,aa:Sec)
FT                   /locus_tag="Aazo_0626"
FT                   /product="transposase"
FT                   /note="Contains selenocysteine; KEGG: ava:Ava_B0073
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63104"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X5"
FT                   /inference="similar to AA sequence:KEGG:Ava_B0073"
FT                   /protein_id="ADI63104.1"
FT                   /translation="MERKSYPTDLADMDWEILAPLIPPAKEGGHPPTTDMGEICNAIYY
FT                   HLKAGCQUNILPGDFPPRSTVYSYYRKWQVQGIWEKFNHTLGGQVRSKLGKSTQPTAFA
FT                   ADSQSVNTDQKKGMCMVLTDVKR"
     atggaacgaa agtcttaccc cacagactta gctgatatgg actgggaaat cctggcccca        60
     ttgattccac cagccaaaga aggagggcat ccacccacaa cagatatggg tgaaatatgt       120
     aatgccatct attatcattt gaaagctgga tgtcaatgaa atatacttcc aggtgacttc       180
     ccgccaaggt caacggtata tagctattac aggaaatggc aggtccaggg gatttgggaa       240
     aaattcaacc atacattggg tggtcaagtt cgctcgaaat taggtaaatc aacacaacct       300
     accgcgttcg ccgcagatag tcagtcagtc aacactgacc aaaaaaaggg gatgtgtatg       360
     gttttgacgg atgtaaaaag gtaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page