(data stored in SCRATCH zone)

EMBL: CP002059.PE452

CP002059.PE452       Location/Qualifiers
FT   CDS_pept        685656..686564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0652"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: ana:all4345
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63120"
FT                   /db_xref="GOA:D7E0Z1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z1"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADI63120.1"
FT                   /translation="MEHNKSFFWPQGILITLLCLTGTVGIGFMMLVKPNISDAQSRHDI
FT                   SSNDIAANVGTQQRIEAFKATILTSWQQEAQEKGITTDVPSRFQGETIKAATLPPDQKV
FT                   IALTFDDGPWPKSTALILDILKRNNIKGTFFVLGQNVQNYPDLTKRIVAEGNTIANHTW
FT                   YHLYHKMNPQTAAYEVANTSDIIFKTTGIKTGLFRPPGGIMNNGVAAYARSNKYAIIMW
FT                   SSDSTDYSRPGVPRLINNIFRSAKPGGIVLMHDGGGDRSHTVKALPEVINKFRKQGYEF
FT                   VTIPEMLEMQDKHQQLLAKKK"
     gtggaacaca ataagtcgtt tttttggccg cagggaatat taattacatt actttgctta        60
     actggtactg taggcattgg ttttatgatg cttgtgaagc caaatatctc tgatgcacaa       120
     agtcggcacg atatcagtag taatgatatt gctgctaacg taggcactca acaacggatt       180
     gaggctttta aggcgacaat actcactagt tggcagcaag aagcacaaga aaaaggtatt       240
     accactgatg tgccatcacg ctttcaaggt gaaacaatta aagccgcaac actcccccca       300
     gatcagaaag tgattgcact tacctttgat gatggacctt ggccgaaaag cacggcgcta       360
     atccttgata ttctcaaaag aaataatatt aaaggcacat tttttgtcct tgggcaaaat       420
     gtacaaaatt atccagattt aactaaacga atagttgctg aaggtaatac cattgctaat       480
     catacttggt atcacttgta tcataaaatg aacccgcaaa ccgcagccta tgaagttgct       540
     aatacatcag atattatttt taaaactaca ggtataaaaa caggtttgtt tcgtccacct       600
     ggtgggatta tgaataatgg agtagcagct tatgctagaa gtaataagta tgcaattatt       660
     atgtggtctt cagactcaac agactattct cgtcctggtg tcccaagatt aattaacaat       720
     attttcagat cagcaaaacc cggtggtatt gtattaatgc atgatggcgg tggtgatcgc       780
     tctcacacag taaaagcctt accagaagtt attaataaat tccgcaagca aggctatgag       840
     tttgtcacta ttccagaaat gttagaaatg caagataaac atcaacagtt acttgctaag       900
     aagaagtag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page