(data stored in SCRATCH zone)

EMBL: CP002059.PE456

CP002059.PE456       Location/Qualifiers
FT   CDS_pept        694498..694917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0656"
FT                   /product="Mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="KEGG: npu:Npun_F3879 mannose-6-phosphate isomerase,
FT                   type II; PFAM: mannose-6-phosphate isomerase type II"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63124"
FT                   /db_xref="GOA:D7E0Z5"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z5"
FT                   /inference="protein motif:PRIAM:5.3.1.8"
FT                   /protein_id="ADI63124.1"
FT                   /translation="MAQFTETLRNNTLTLNATLNSRGVAAGELRPWGSFTVLEEGRGYK
FT                   IKRIEVKSGHRLSLQMHHHRSEHWIVVSGTAKVVCGENEVLLSNNQSTYVPQCTVHRLE
FT                   NPGVIPLVLIEVQNGEYLGEDDIIRYQDDYARSDK"
     atggctcaat ttacagagac cttacgtaac aacactctca ccctaaatgc aacccttaat        60
     tccagaggcg ttgccgccgg tgaattacgc ccttggggtt cttttacagt tttagaagaa       120
     gggcgcggat acaaaataaa acgcatagaa gttaagtccg gacatcgcct tagcctacaa       180
     atgcaccacc accgtagcga acactggata gtcgtttccg gtacagccaa ggttgtctgt       240
     ggtgaaaacg aagttttact aagcaataat cagtctacct atgtacccca atgtactgtt       300
     caccgtttag aaaatcctgg ggtaattccc ttggtgctaa ttgaagtgca aaatggcgaa       360
     tacttgggcg aagatgatat tatccgctac caagatgatt atgctcgcag tgacaaatag       420
//

If you have problems or comments...

PBIL Back to PBIL home page