(data stored in SCRATCH zone)

EMBL: CP002059.PE457

CP002059.PE457       Location/Qualifiers
FT   CDS_pept        694892..695005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63125"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63125.1"
FT                   /translation="MIMLAVTNSVWDLGAWGKSIVSSDSVPYRKQATLSVP"
     atgattatgc tcgcagtgac aaatagtgtg tgggatttgg gagcatgggg aaaatcaatt        60
     gtttcttctg atagtgtacc ctataggaag caagctacac ttagtgtgcc gtag             114
//

If you have problems or comments...

PBIL Back to PBIL home page