(data stored in SCRATCH zone)

EMBL: CP002059.PE460

CP002059.PE460       Location/Qualifiers
FT   CDS_pept        696356..696826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0660"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: npu:Npun_F3882 ribosomal protein S7; TIGRFAM:
FT                   ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63128"
FT                   /db_xref="GOA:D7E0Z9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z9"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADI63128.1"
FT                   /translation="MSRRGVSQRRPVPSDSVYNSRLVSMIIRRIMRHGKKSLAARIVYD
FT                   ALRSIEERTGNSALETFERAVRNATPLVEVKARRVGGATYQVPMEVRSDRGTTLALRWL
FT                   VQFSRSRPGRTMASRLANELMDAANETGSAIRKREETHRMAEANKAFAHYRY"
     atgtctcgtc gtggtgttag tcaaaggcgc ccagttccgt ctgactcagt atataacagt        60
     cgccttgtga gcatgattat caggcggatc atgcgtcatg gcaagaaatc acttgccgcc       120
     agaattgtgt atgatgcttt aagaagtatt gaagaacgca ctggtaacag tgctttggaa       180
     acatttgaaa gagcagtgcg taacgccact cctttggtag aagtaaaggc tcgacgagta       240
     ggtggagcaa cttaccaagt accaatggaa gtacgttctg atcggggtac tacgttagca       300
     ttgcgttggt tagtgcagtt ctctaggtct agacctggtc gcacgatggc cagtagacta       360
     gcaaatgagt taatggacgc tgctaacgaa acgggaagcg ccattcgcaa gcgggaagaa       420
     acgcaccgca tggctgaagc aaacaaagca tttgcacact atcgttacta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page