(data stored in SCRATCH zone)

EMBL: CP002059.PE475

CP002059.PE475       Location/Qualifiers
FT   CDS_pept        712434..712646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0675"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63143"
FT                   /db_xref="UniProtKB/TrEMBL:D7E114"
FT                   /inference="similar to AA sequence:KEGG:Ava_1224"
FT                   /protein_id="ADI63143.1"
FT                   /translation="MIKYLVILLSLIFSLSFTSPAFALVCHNYDGYEVCILNIKRSAKK
FT                   YREHRAAITVDGVKESTCRSSQFSY"
     atgattaaat atttggtcat tttactgtcg ttgatatttt ctttgtcttt cacatctcca        60
     gcgtttgctc ttgtttgtca caattatgat ggatatgaag tctgtattct taatattaaa       120
     cgcagtgcta agaaatatag ggaacatagg gctgctataa ctgttgatgg tgtgaaagaa       180
     agcacctgta gaagttcaca attctcgtac taa                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page