(data stored in SCRATCH zone)

EMBL: CP002059.PE493

CP002059.PE493       Location/Qualifiers
FT   CDS_pept        complement(733119..736142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0696"
FT                   /product="exonuclease SbcC"
FT                   /note="KEGG: npu:Npun_F1577 exonuclease SbcC; TIGRFAM:
FT                   exonuclease SbcC; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63161"
FT                   /db_xref="GOA:D7E132"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D7E132"
FT                   /inference="protein motif:TFAM:TIGR00618"
FT                   /protein_id="ADI63161.1"
FT                   /translation="MIPVQLILKNFLSYRDATLDFGGLHTACICGSNGAGKSSLLEAIT
FT                   WSIWGQSRATVEDDVIYSGAKEVRVDFTFYNNQQTYRVIRTRARGATSILEFQIETPAG
FT                   FRPLTRKGMRATQDVIIQHIKLDYETFINSAYLRQGRADEFMLKRPTERKEILAELLKL
FT                   DQYDVLEERAKDSSKLYKGRAEELERSLDNIKVQLQQQETTKAQRVELESQLNSLQQQQ
FT                   ALDNIQLQSLQVVEHKRQNWEQQLNFVWQQYQNLSQDCDRLHEEQLAVKSQLADLKVIL
FT                   NQAAEIIAGYAQYQSLQSQEEAFAVKSEQHTRATSFRQQQQQELTKQVQTIEYRFQQAQ
FT                   AQLEGLEQQEQEIQQTLTKSSEVETALAQLASARKHLNYFDQLQMQVNPLLQQRLSLQN
FT                   QLDRTRASLVARLEQLQATETQLQSQYRRQPQLQQAALDVGIQIEELEKKRVYLQRVQE
FT                   KGQERRHFIERLQVHQRDYEKLLGELEQKLQVLQSPNALCPLCERHLDEHHWSRVIQKT
FT                   QLEYEDTQGQFWVVREQMAVSDREIQVLRQEYREISQQLAGYDALREQRGQLAAKLQAT
FT                   TDVQEQLQQIALEREHLESSLQGDYAPDKQVELQQLEQYLQQLNYNEQDHTLARSEVER
FT                   WRWAEIKQAQIKDATKKQAQLAARKPKLQATIDEFKLKIQLEQTDSDTAKQIEALTQEI
FT                   KELNYSSEQHNKLRQAVRESQSWQLRYQQFLSAQQKYPQLETRLEDLASSYKSRLADQQ
FT                   RFATQIDSIVEQLKATANPTEQINALEQQIAIRRRELDEKIANLGRVEQLLHQLQTLQT
FT                   QYVQEQEQLKYCQQQHRVYHELTQAFGKNGIQALMIENVLPQLEAETNQLLSRLSANQL
FT                   HVQFVTVKAGRSGKSTRKHTKLIDTLDILIADGRGTRAYETYSGGEAFRINFAIRLALA
FT                   KLLAQRAGAALQLLIVDEGFGTQDNEGCDRLIAAINAIASDFACILTVTHIPHLKEAFQ
FT                   ARIEVNKTQQGSHIYLSI"
     atgatcccag ttcaacttat ccttaaaaac ttccttagtt accgtgatgc aactttagat        60
     tttggcggtt tgcatacggc ttgtatttgt ggttctaatg gtgcaggtaa atcttccctt       120
     ctggaagcta tcacttggtc tatttggggt caaagccgtg ccactgttga agatgatgtt       180
     atctattctg gcgcaaaaga agtcagagtt gattttactt tctacaataa ccaacaaact       240
     tatcgcgtaa ttcgtactcg cgcacggggt gccactagca tcctggaatt tcaaattgaa       300
     actcctgccg gttttcgtcc cctaactcgc aaagggatgc gagcaacgca ggatgtgatt       360
     atacaacata tcaagctcga ttacgaaacc tttattaatt ctgcttactt acgtcaagga       420
     cgagcagatg aattcatgct caaacgtcct actgaacgga aggaaatttt agcggagttg       480
     ttaaaactcg atcaatatga tgtattggaa gaaagagcta aggacagttc taaactttat       540
     aaaggaaggg cggaagagtt agagcgttct ttggataata tcaaagttca actccaacaa       600
     caggaaacaa caaaagcgca aagagtggag ttagaatctc aacttaatag tcttcaacag       660
     cagcaagctc ttgataatat tcaattgcaa agtttgcaag ttgtcgaaca taaacgccaa       720
     aactgggaac aacaactgaa ttttgtctgg caacaatatc aaaatcttag ccaagattgt       780
     gatcgcttgc atgaagaaca attagctgtt aaatcccaat tagcagattt aaaagtcatt       840
     ttaaatcaag ctgccgaaat tatcgccgga tacgctcaat atcagagtct acaatcccaa       900
     gaagaggctt ttgctgttaa atctgaacaa catacccgcg ctaccagctt ccgacaacaa       960
     caacaacaag agcttactaa acaagtccaa acaattgaat accgatttca acaagctcaa      1020
     gctcaattag aaggtttaga acaacaagag caagaaattc aacaaactct cactaaatct      1080
     tcggaagtag aaactgcttt agctcaatta gcttcggctc gtaagcatct taattatttc      1140
     gatcagttgc aaatgcaagt gaatccttta ttacaacaac ggttaagttt acagaatcaa      1200
     ttagatcgca ctcgtgctag tttagtagcg cggctggaac aactgcaagc tacagaaacc      1260
     caactccaaa gtcaatatcg tcgtcaacca caactacaac aagcggcgct agatgtgggt      1320
     atacaaattg aagaactgga gaaaaaacgg gtgtatttac agcgggtgca ggaaaaagga      1380
     caggaacgca ggcactttat cgaacgttta caagtacacc aacgagatta cgagaaatta      1440
     ctgggagaac tagagcagaa attacaagta ctccaaagtc ctaatgcttt gtgtcctttg      1500
     tgtgaacgtc atctagatga gcatcactgg agtcgggtta tacaaaaaac ccaactagag      1560
     tatgaagata cccaaggaca attttgggta gtgcgggaac aaatggcggt ttctgacaga      1620
     gaaattcagg tacttagaca agaatatcga gaaatttctc agcaattagc tggttatgat      1680
     gctttgcgtg aacaaagggg acaattagct gcaaaattac aagcaactac agatgttcaa      1740
     gagcagttac aacaaattgc tctggaaaga gaacatttag aaagttcttt gcaaggagat      1800
     tatgctcctg ataaacaagt agaactccag caattagagc aatatctgca acagttgaat      1860
     tataatgaac aagaccatac tttagctaga agtgaagtag agcgttggcg atgggcagaa      1920
     attaaacaag cacaaattaa agatgctact aaaaaacagg ctcaattagc agccagaaaa      1980
     ccaaaattac aagctactat tgacgaattt aagctcaaaa ttcagttaga acaaacagat      2040
     tctgatacag ctaaacaaat agaagcttta actcaggaaa ttaaagagct taactacagt      2100
     tctgaacaac acaataagtt gcgtcaagct gtacgtgagt cacaatcttg gcagttgcgt      2160
     tatcaacagt ttttgtcggc tcaacaaaag tatcctcaac ttgagacaag attagaagat      2220
     ttggcaagtt cttacaagag tagattagca gatcagcaaa gatttgctac tcaaattgac      2280
     agcattgtag agcaattaaa agctacagcg aacccgacgg agcaaattaa tgctttagaa      2340
     cagcaaatag cgattcgcag aagggaactt gacgagaaaa tagctaattt ggggcgtgta      2400
     gaacaactat tacatcaatt acaaacgttg cagactcagt atgtgcaaga acaggaacaa      2460
     ttaaaatatt gtcagcagca acatcgtgtt tatcacgaat taacgcaagc ttttggtaaa      2520
     aatggtatcc aagcgttgat gattgaaaat gtgttaccac aactagaagc tgagacaaat      2580
     caactacttt cacggttgag tgctaatcaa ctacacgtac aattcgttac tgtgaaagcg      2640
     ggacgtagtg gaaaatcaac taggaaacat actaagttga tcgatacttt agatatctta      2700
     attgctgatg ggaggggaac gcgagcctat gaaacttatt ctgggggcga agcgtttaga      2760
     attaattttg cgattcgctt ggccttagcg aaattattag ctcaacgtgc gggagcagcc      2820
     ttacaactgt taattgtaga tgaaggcttt gggactcagg ataatgaagg gtgtgatcgc      2880
     ttgattgcgg cgattaatgc gatcgctagt gatttcgcct gtatacttac agtaactcat      2940
     attccccacc tcaaagaagc cttccaagcg cggatagagg ttaacaaaac tcaacaaggt      3000
     tcacatatat atctatcaat ttaa                                             3024
//

If you have problems or comments...

PBIL Back to PBIL home page