(data stored in SCRATCH zone)

EMBL: CP002059.PE494

CP002059.PE494       Location/Qualifiers
FT   CDS_pept        complement(738634..738885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0699"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63162"
FT                   /db_xref="UniProtKB/TrEMBL:D7E133"
FT                   /inference="similar to AA sequence:KEGG:Ava_2120"
FT                   /protein_id="ADI63162.1"
FT                   /translation="MKAVEVTGTTDEKEQFLLDQAINVEIPGRVRVILLFDRSTDELEN
FT                   DPDDTPIKSVKASLKILLQQAKAGEHILLAQMWEGIGF"
     gtgaaagccg tagaagttac aggaacaact gacgaaaaag aacaattctt attagaccaa        60
     gccatcaatg tagaaatacc tggtcgtgtc cgagttattc ttctatttga tagatctaca       120
     gatgaattag aaaatgaccc agatgatact cctattaaat ctgtcaaagc aagtctcaaa       180
     attttattac agcaagcaaa agctggagaa catattctac ttgctcaaat gtgggaggga       240
     attggtttct aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page