(data stored in SCRATCH zone)

EMBL: CP002059.PE513

CP002059.PE513       Location/Qualifiers
FT   CDS_pept        766734..769775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0728"
FT                   /product="cyclic nucleotide-regulated ABC
FT                   bacteriocin/lantibiotic exporters"
FT                   /note="KEGG: ana:alr1927 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; peptidase C39
FT                   bacteriocin processing; cyclic nucleotide-binding; ABC
FT                   transporter transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63181"
FT                   /db_xref="GOA:D7E1F4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI63181.1"
FT                   /translation="MPSAFSQSYLATQITKIVGDSLSDQELENCVQALDIIEPPIAKQF
FT                   WISTTAPPGIYLVLSGKVRLLDGGNNLISTLTSGSSFGELTLFPEQNFSAYVARASVNL
FT                   KVGYLPQEVINRFVGVSDRLFIKAELWDILVLLSQNSATPRHESVEEILTALSLFAKQN
FT                   LEIGSLNPQVTENTKLLLVCQGELQHCQGKKLTPGNIYVNPHKEKWQATQPSRVYILHD
FT                   ADLQTALQYWPQLSRLIDVENEPITEPIKREVKARSRNVIQFPQTTIQEQSQPKQSQKY
FT                   FPSPTVTAGNWWRKVSKRYPFCEQQSASDCGAACLVMISRYWGKNFTINRLRELANINR
FT                   AGASMRSLTAAAESIGFATRPVKASLDKLAQQTLPAIAHWEGKHYIVVYEITEKWVIVA
FT                   DPAIGQLNLSIREFKAGWTGYALLLQPTNSLQTIPEANTPFWQLFELVKPHYQVLLEVF
FT                   VASVLIQVFGLVTPLFTQLLLDRVIVQGSTITLNTVGFGLLIFSLFRVVINGLRQYLLD
FT                   HTANRISVALMVGFIKHTFRLPLSFFESRYVGDIVSRVQENQKIQRFLTGEALSIVLDF
FT                   LTVFIYISLMFWYSPSMALLVLAIVPPFVLLALFATPFLRRTSREVFTAVTKENSYLIQ
FT                   SLTGISSIRSMAIEQTVRWRWEELLNNLTKKNFSVQVIGNQLEIISSTIQAIASTGLLW
FT                   FGAWLVIQNQLTIGQLVAFNMLLGNVIQPFQRLISLWNQLQEVIVSTERINDVLEASPE
FT                   EDLAVHSRQILPRLRGHLHFDNVTFRYHAESDINILENLSFEILPEQTVAVVGRSGSGK
FT                   TTLSKLILGLYPATDGRVLIDNQDVASISLHSLRSQIGVVDQDTFLFGGTIRENISIAH
FT                   PEATLEEIIEAAQLAGADEFIKRMAMGYETQIGEGGGMLSGGQRQRLAIARALLGSPRL
FT                   LILDEATSHLDAESERIIQNNLKTILKGRTSFIIAHRLSTVRHADLILVLDRGILVESG
FT                   THEELILKRGHYYYLNQQQLASTG"
     atgccatcag cgttttctca gtcatattta gcaacacaaa ttaccaaaat tgtgggtgat        60
     tcgctatcag atcaagaact tgaaaattgt gttcaagcat tagatattat tgaaccacca       120
     atagccaaac aattctggat atcgacaaca gcaccaccag gaatttatct agttttgtcg       180
     ggtaaggtca ggctattgga tggtggaaat aatttgattt caactttgac ttctggttca       240
     tcttttgggg agttgacttt atttcccgaa caaaatttta gtgcttatgt agcgagggct       300
     tctgtaaatt taaaggtcgg ttatcttccc caggaggtaa ttaatagatt tgtgggtgtg       360
     agcgatcgcc tattcataaa ggcagaactt tgggatatac tggtgttatt atctcaaaac       420
     tctgctacac ctcgtcatga atcggtagag gagatactaa cagcattatc tctatttgca       480
     aaacaaaatc tagaaattgg ttctctaaat cctcaagtga ccgaaaatac caaactattg       540
     ctagtgtgtc agggggaatt acaacattgt cagggtaaaa aattaacgcc aggtaacatt       600
     tatgtaaatc cccacaagga aaagtggcaa gcaacacaac ccagcagagt atacattttg       660
     catgatgctg atttgcaaac agcactacaa tattggccgc aattaagtag gttaattgat       720
     gtagaaaatg agccaattac agaaccaatc aagcgcgaag ttaaggctag aagccgcaat       780
     gtgattcaat ttccccaaac cacaatccag gaacaatcac aaccaaaaca aagccagaaa       840
     tactttccta gtcctactgt caccgctgga aattggtggc gtaaagttag taaacgctat       900
     ccgttttgtg aacaacaaag cgcctctgat tgtggtgcgg cttgtttggt gatgattagt       960
     cgttattggg gtaagaattt taccattaat cgcttgcgag aactggctaa tattaaccgt      1020
     gctggtgcat ctatgcggag tttaactgcg gcggctgaaa gtatcggttt tgctactcgt      1080
     ccggtgaaag ctagtttaga taaattagca caacaaacgt tacctgcgat tgcacactgg      1140
     gagggtaaac attacatcgt cgtctatgaa attaccgaaa aatgggtaat tgtcgccgat      1200
     cctgctatcg gtcaacttaa tctgtctatt cgagaattta aagcaggttg gactggttat      1260
     gcattgttat tacaaccaac aaactcactt caaacaatcc cagaagctaa cacaccattt      1320
     tggcagttat ttgagttagt aaaacctcat taccaggtac tgctagaagt atttgttgct      1380
     tcagtgttaa ttcaagtatt tggattggtg acacctttat ttactcaact attattagac      1440
     agagtaattg tccaaggtag caccattact ttaaatactg ttgggtttgg gttacttatt      1500
     tttagcttat ttcgtgttgt tatcaatgga ctcagacaat atttactaga ccacacagct      1560
     aacagaatta gtgtggcctt gatggtaggt tttattaaac atacctttcg tttacctctc      1620
     tcattttttg agtctcgtta cgttggtgat attgtttctc gtgtccaaga gaatcaaaaa      1680
     attcagcgtt tcttaactgg tgaagcacta tctattgttt tagattttct gacagtattt      1740
     atctacatca gcttgatgtt ttggtacagt ccttcaatgg ctttattggt tttggcaatt      1800
     gtaccaccct ttgtattact agccctcttt gccacacctt ttttaagacg aactagtcgt      1860
     gaagttttta cggcggtgac aaaagaaaat agttacttaa ttcaaagttt aacgggaatt      1920
     tcctcgattc gctcaatggc tattgaacaa acagtaagat ggcgttggga agaattgctg      1980
     aataatttga ctaagaaaaa cttcagtgtt caagtaattg gaaatcaact ggaaattatt      2040
     agttctacaa ttcaagccat agccagtaca ggattattgt ggtttggagc atggttagta      2100
     attcagaacc agttaaccat tggacagcta gtagctttta atatgttact aggtaacgtt      2160
     attcagcctt tccaaaggtt aattagtttg tggaatcagt tacaagaagt gatagtttct      2220
     acagaacgaa ttaatgatgt tttagaagca agcccagaag aggatctagc agttcactca      2280
     cgtcaaatat tacctagatt acgtggccat ttacattttg acaatgtaac ttttcgctat      2340
     catgctgaaa gcgatattaa catcctagaa aatctcagtt ttgagatctt acctgaacaa      2400
     actgttgcag ttgtagggcg gagtggttca gggaaaacaa ctctttctaa gttgattttg      2460
     ggtttatatc cagcgacaga tggccgagta ttaattgaca atcaagatgt ggctagtatt      2520
     tctctgcatt cattgcgctc gcaaatagga gttgttgacc aagatacatt tttatttggc      2580
     ggtacaattc gagaaaatat tagcatagct catccagaag ctaccctaga agaaattatt      2640
     gaagcagccc aacttgcagg tgcagatgag tttattaaac gcatggctat gggttatgaa      2700
     acccaaatcg gtgaaggtgg aggaatgtta tcagggggac aacgccaacg cctagcaata      2760
     gctcgtgcat tattaggaag tccgcgcctt ttaatattag atgaagcaac cagtcatctt      2820
     gatgcagaat ctgagcgcat tattcagaac aatctgaaaa caattctcaa aggacgcacg      2880
     agttttatta tcgcccatcg tctttccacc gtgcgtcatg ctgacctaat tttagtttta      2940
     gatcggggga ttttagttga aagtggtact catgaagaat taattctcaa gagaggacat      3000
     tattactatc ttaatcaaca acaactagcg tcaacaggct ga                         3042
//

If you have problems or comments...

PBIL Back to PBIL home page