(data stored in SCRATCH zone)

EMBL: CP002059.PE517

CP002059.PE517       Location/Qualifiers
FT   CDS_pept        complement(773602..774699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0732"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all1931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63185"
FT                   /db_xref="InterPro:IPR040871"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F8"
FT                   /inference="similar to AA sequence:KEGG:all1931"
FT                   /protein_id="ADI63185.1"
FT                   /translation="MQLLDSLHTQLSELPEQLQISLQDIATQIEIASHHCIKHPKHKTI
FT                   ALPESVIPRFEQLPLEMQQQHLKLQLRNFIYSVYYNVASKPIISADEKESNRKIKQNLE
FT                   NKNLFGIDLEFYDRLHTRNKSEGYWSHNWQVVREETDGTLAVHKNGLTLHVDPNLHLLP
FT                   TVTSWVVGKFVSIKMPKNLVQNGFYMAVANAGSQNGHNITRIYFNLTPEGAAAVMESLT
FT                   VQLNNIPISFSFKALYNPPDYGRYDSAVLYFNKDQYEIVHPALERIYADNQSYFDEPVP
FT                   LFTKQLAPGLACAEEPNQKFGDKESFGTNRCQIIANALVTAWQQGEHSPDKRMASIFKQ
FT                   FASHKIQLQRPYLNANSEDIYTPLS"
     atgcaactat tagattcact ccatacacaa ctgtccgaat tgccggaaca attgcaaata        60
     tcactgcaag atattgcgac tcagattgaa attgcatctc accactgtat taaacatcca       120
     aagcacaaaa ccatagcgtt gccagagtcg gtcatacctc gctttgagca gttaccatta       180
     gagatgcagc aacagcattt aaaactacaa ctgcgtaatt tcatatacag tgtttattat       240
     aacgttgcct caaagcctat tatcagtgct gatgagaagg aaagcaatag gaaaattaag       300
     caaaatcttg aaaataagaa cttattcggc atagatttag aattttacga tcgcttacat       360
     accaggaaca aaagtgaagg ctactggagt cataactggc aggtggtcag ggaagaaacg       420
     gatggcactt tagcagtgca taagaatggg ttaacactgc atgttgatcc aaatttgcat       480
     ctgttaccaa cagttacctc ttgggttgtt ggtaagtttg tatctatcaa aatgccaaag       540
     aatttggtac aaaacgggtt ttatatggct gtagctaatg caggctccca aaatggtcat       600
     aatattacgc gaatatactt taatttaaca ccagaagggg cagccgccgt aatggaaagt       660
     ttaacagtcc aactaaataa tattcccatt tctttttcct tcaaagcact atataatcct       720
     cccgattatg gacgttatga ctcagccgtg ctttacttta acaaagacca atatgagata       780
     gttcacccag cattagaaag aatctatgca gataatcaat cctattttga tgaaccagtg       840
     cctttgttta ctaagcaatt agcaccgggg ttagcgtgtg cagaagaacc aaaccaaaaa       900
     tttggtgata aagaaagttt tggtacaaat cgttgtcaaa ttatcgctaa tgctttagtt       960
     actgcttggc agcaaggtga acatagtcca gataaaagaa tggcatctat ttttaagcag      1020
     tttgcatcac acaagattca gttacaacgt ccttatctta atgctaactc tgaggatatt      1080
     tacactccct tgtcttaa                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page