(data stored in SCRATCH zone)

EMBL: CP002059.PE523

CP002059.PE523       Location/Qualifiers
FT   CDS_pept        complement(780888..782507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0739"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="KEGG: npu:Npun_R2847 peptidase M16 domain-containing
FT                   protein; PFAM: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63191"
FT                   /db_xref="GOA:D7E1G4"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G4"
FT                   /inference="protein motif:PRIAM:3.4.24.64"
FT                   /protein_id="ADI63191.1"
FT                   /translation="MNYSILDSWKSKTNKSQFRYSQLFHKFPFSPVLHRLLITALAVMI
FT                   FCLGVTPQAAIALEPTQSLIQPYLDQVVKQLTEFRLDNGLKFIVLERHQVPVVSFLTYA
FT                   DVGGIDESDGKTGVAHFLEHLAFKGTKRIGTIDYKAEKPLLESLEQLDTQIRTAKSQGK
FT                   NDDLAKLETEFKSLESQALKLVKQNEIGQIVEQAGGVGLNANTSTEATRYFYSFPANKL
FT                   ELWMSLESERFLDPVFREFYKEKDVILEERRMRVENSPVGLMVEKFIDTAFKVHPYRRP
FT                   VIGYDEDIRNLSPKDVKQFFDSYYVPNNLVIAIVGDVKPNEVKKLAQVYFGRYPAKLKA
FT                   QAKITPEPKQTEPREFTLKLPTQPWYFQGYHRPGITHPDNAVYDIIGSLLSDGRTSRLY
FT                   KSLVEKQSLALAAHGVSGFPGDKYPNLILFYALTSPGHTVDDLAIALGKEIEKLKTEPV
FT                   STTELQRVKTQARAGLLRSLDSNMGMAQQLLEYEVKTGSWRNLFKQLENIAAVTPADIQ
FT                   RVAQVTFTRENCTVGKLLSKEG"
     atgaattatt caattttgga ttcctggaag agtaaaacta acaagtctca atttagatac        60
     tctcaattat tccacaaatt tcctttctct ccagttttgc atcgtttgtt aataactgct       120
     ttggcggtaa tgatattttg tttgggtgta acaccacaag ctgcaatcgc actggaacct       180
     acccaaagtt taattcaacc atatttagat caagtagtta agcaattaac agaatttcgc       240
     cttgataatg gcttgaagtt cattgttttg gaaagacacc aagtgccagt ggtttctttt       300
     ttgacttatg ctgatgtggg tgggatagat gaatcagatg gtaaaacagg tgtagctcac       360
     tttttagaac atttggcttt taaagggaca aaacgtattg ggacaataga ttacaaagcc       420
     gaaaaaccgc tactagaaag tttagaacag ttagataccc aaattagaac tgctaaatcc       480
     caaggtaaaa atgatgattt agcaaagtta gaaactgagt ttaaatcatt agaatctcaa       540
     gcactgaaac tagtcaaaca gaacgaaatc gggcaaattg ttgagcaagc ggggggtgta       600
     ggtttaaatg cgaatacttc caccgaagct acacgttatt tctacagttt tccggctaat       660
     aagttggaac tgtggatgtc tctggagtca gaaagatttt tagatcctgt atttcgggag       720
     ttttataaag aaaaagatgt gattttggaa gaaagacgga tgcgggtaga aaactctccc       780
     gttggtttga tggttgagaa atttattgat actgctttca aagttcatcc ctacagacga       840
     ccagtgattg gttatgacga agatattcgc aatttgtcac cgaaagatgt gaagcagttt       900
     tttgacagtt attatgttcc taacaatcta gtgatcgcta ttgtcggtga tgttaagcct       960
     aatgaggtga aaaaattagc acaagtttac tttggacgtt atccggctaa acttaaagcc      1020
     caagcaaaaa tcacccccga acctaagcaa actgaaccca gagaatttac cttaaagtta      1080
     cctactcaac cttggtattt ccaaggttat caccgtccag gtatcaccca ccccgataat      1140
     gcagtttacg acattattgg tagtttattg agtgatgggc gcacttcacg attgtataag      1200
     tctttggtgg aaaagcagag tttagccctt gcggctcacg gtgtaagtgg gtttcctggt      1260
     gataaatatc ccaatttgat cttattttat gctctcacat ctccaggtca tacagttgat      1320
     gatttggcaa tcgcactggg aaaagaaatc gaaaagttga aaactgagcc tgtctccaca      1380
     actgagttac agcgagtgaa aactcaagcg cgggctggtt tgttacgtag tcttgattcc      1440
     aatatgggta tggcgcagca gttattggaa tatgaagtga aaaccggctc ttggcggaat      1500
     ttatttaagc agttagagaa tattgcagca gtgacacctg ctgatattca gcgtgtagca      1560
     caggtgactt ttacccggga aaattgcact gttggtaagt tgttgtcgaa ggaaggatag      1620
//

If you have problems or comments...

PBIL Back to PBIL home page