(data stored in SCRATCH zone)

EMBL: CP002059.PE526

CP002059.PE526       Location/Qualifiers
FT   CDS_pept        785658..789311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0744"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="KEGG: npu:Npun_R5741 chromosome segregation protein
FT                   SMC; TIGRFAM: chromosome segregation protein SMC; PFAM: SMC
FT                   domain protein; SMCs flexible hinge domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63194"
FT                   /db_xref="GOA:D7E1G7"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G7"
FT                   /inference="protein motif:TFAM:TIGR02169"
FT                   /protein_id="ADI63194.1"
FT                   /translation="MVHIKRVELTNFKSFGGTTSVPLLPGCTVISGPNGSGKSNILDGL
FT                   LFCLGLASSKGMRAERLPDLVNNAQKHKGRSSLEASVTVTFDLSDIVLCRKPEGEREEV
FT                   KEVEEAGETGDIGEEEDNNSQSPVPSPQSPKEWSVTRRLRVTQQGTYTSNYYINGVSCT
FT                   LTELHEQLQELRVYPEGYNVVLQGDVTSIISMNARERREIIDELAGVAAYDRKIIQAKS
FT                   TLDKVKEREDSCRIIETELIVQRDRLGQEKAKAERYQKLRTEFVHKQSWQTVLSYRSLQ
FT                   VQHEKLTAQIQAGEQSFTDFTNQLHTVNSDISQKTLELEELNSRVKALGEEELLAVQSN
FT                   LAIHEVERKEFQRQQRDLETALKESARRLMQTQEGIQQYQVSLSQAIEQQDVETAQVIS
FT                   FKQQRNETQQALEASRQAVAEIASASEAWVKQQTVLNRQIETLLQTLEPQRTEQAQLEE
FT                   RNTQLKQLIHEQSELIATLEPELADKQVECNQLETEFNASTVPIQNLAENLAATEQELQ
FT                   IQQETQKRLLQEQREKQRQLDKLEAQAQAQQEVQGTQASKIIIQSGLPGLCGLVVHLAK
FT                   VEYRHHLALETAAGARLGHIVVEDDRVASAGIELLKQKRVGRATFLPLNKIQAPKFTPD
FT                   LTLRYADGFVEYAMNLVECDRRYQEVFKYVFGNTVVFTTLEQARKQIGLYRIVTLDGEL
FT                   LETSGAMTGGSNTQRSALKFGIGEAKESEEVSSLKTRLADIDRVLDRCLEAISNLSSYS
FT                   KKLSQEFIEERQARLEQQLRLEQLEKDIKTLTAQVETARCQLSQNTEKVTTAQTRLEIL
FT                   NRELPGLENQLQQLRHTLSELESSQTSSEWQQIQAVIKTQEQQLQGKETALRDAQEQLK
FT                   SLENQQQRLQEKTQEAQTRVIEYQQEQTTVNNQLATVTSQLTELNSQITAIQADLKQLE
FT                   ENLGEEKKKRDITETGVRALLLRQQKLQWELEKLQETQEKRREDLTALQTQFRDLGAEL
FT                   PNPLPEVPAQVELEELQQELRSLAKRLQTMEPVNMLALEDYDKVQNRLQELTDKLHTLE
FT                   AERTELLLRIENFTSLRQIAFKEAFDAVNENFQSIFATLSDGDGYLQLDNIEDPFNSGL
FT                   NLVAHPKGKPVQRLASMSGGEKSLTALSFIFSLQRYRPSPFYAFDEVDMFLDGANVERL
FT                   AKMIKQQAQQAQFIVVSLRRPMIQSAERTIGVTQARGAYTQVLGIKLQSSS"
     atggtgcata tcaagcgcgt tgaacttaca aacttcaaat ccttcggcgg tactacttct        60
     gtccctttac tgccggggtg tactgtcata tctggaccca atggttctgg taaatcaaat       120
     attctcgatg gtttgctgtt ttgtttggga ctagctagtt ctaagggaat gcgggctgaa       180
     cgtttaccag atttggtgaa taatgcccaa aagcataagg ggcgttcctc cttggaagcc       240
     agtgtgacag tgacctttga tttatcagat attgtcttat gcagaaagcc agagggggag       300
     agggaggaag taaaggaagt agaggaagca ggggaaacag gagatattgg ggaggaagag       360
     gacaataatt cccagtcccc agtccccagt ccccagtccc caaaagaatg gagtgttact       420
     agacgcttaa gggtgacaca gcaaggaact tatacgtcca attattatat taatggtgtt       480
     tcttgcactc tgactgaatt gcatgagcaa ttacaggaac tgcgggttta tcctgaaggg       540
     tataatgtgg tgttgcaggg tgatgtaact agcattatct cgatgaatgc gcgggaacgt       600
     cgggaaatta ttgatgagtt ggctggggta gcggcttatg atcggaagat tattcaagct       660
     aagtcaactt tggataaggt gaaggaaagg gaagacagtt gtcggattat tgagactgag       720
     ttaattgtac agcgcgatcg cttgggtcaa gagaaggcta aggcagaaag atatcaaaag       780
     ttacggacgg aatttgttca taagcagtct tggcaaactg tgttatccta ccgttctctc       840
     caagtacagc acgaaaagtt aacagcacaa attcaagctg gtgaacaatc ttttacggat       900
     tttaccaatc aacttcacac tgttaactcg gatatttctc aaaaaactct tgaacttgag       960
     gaactcaatt ctcgtgtcaa agctttgggg gaagaggaac ttttagcggt tcagtctaac      1020
     ctcgctattc acgaagtaga acgcaaggaa tttcaacgtc agcagcgcga tttagaaacg      1080
     gctttaaaag aatctgcaag acgtttgatg caaactcagg aaggaattca acaatatcaa      1140
     gtttctctgt cacaagctat tgaacaacaa gatgtagaaa ctgcacaggt aatatcgttt      1200
     aaacaacaac gaaatgagac gcaacaagct ttagaagctt ctcgtcaagc ggtagctgag      1260
     attgcttcgg cttcagaagc ttgggtaaaa caacaaactg tgttaaatcg ccaaattgaa      1320
     actttactgc aaactctcga acctcaacga actgaacaag cacaactgga agaaagaaat      1380
     actcagttaa agcaacttat tcatgaacaa tccgaactaa ttgccacttt agaaccggaa      1440
     ttggcagaca agcaagttga atgtaatcaa ctggaaacgg aatttaatgc ttctaccgtg      1500
     cctattcaaa atttagctga aaatctggcg gcgacggaac aagagttaca aattcaacag      1560
     gaaactcaaa agcgactttt gcaagaacaa cgggaaaaac aacgccagtt agataaattg      1620
     gaagcccaag cccaagcaca gcaggaagtt cagggtacac aagcgagtaa gataattatt      1680
     caatctggtt tacctggttt gtgtgggttg gtggtacacc ttgctaaggt ggaataccgc      1740
     catcatttgg ctttggaaac tgcggcgggt gcgcgtttgg gacatattgt ggtggaagat      1800
     gacagagtgg catctgcggg gattgagttg ttaaaacaaa aacgcgtggg gagagcaact      1860
     tttttacctt tgaataaaat tcaagctcca aaatttaccc cagatttaac tttgcgttat      1920
     gcggatgggt ttgttgaata tgctatgaat ttggtagagt gtgatcgccg ttatcaagaa      1980
     gtatttaagt atgtatttgg taatacggta gtttttacca ctttagaaca agccagaaaa      2040
     caaatcggtc tttatcgtat tgtcacccta gatggtgaat tattagaaac cagcggtgca      2100
     atgacaggag gaagcaatac tcagcgttca gcgttaaaat ttggcatagg tgaagcaaag      2160
     gaatcggaag aagtatccag tttaaagaca agattggcag atattgaccg cgttttagat      2220
     cgttgtctag aagcaatctc taatttatct agctacagta agaaactttc ccaagaattt      2280
     atagaagaac gtcaagcacg actggaacag cagttacgtt tagaacagtt agagaaagat      2340
     atcaagactc taaccgcgca agtagaaact gcacgctgtc aattatccca aaacaccgaa      2400
     aaagttacca ctgcacaaac tcgtctggaa attttaaatc gggaactacc aggtttagaa      2460
     aatcaattgc aacaattaag acatactttg tcagagttgg aatcgtctca aacttctagc      2520
     gaatggcaac aaatccaagc agtaattaaa actcaggagc aacaattaca aggaaaagaa      2580
     accgctttaa gggatgcaca agaacaattg aagagtttag aaaatcaaca acaacgttta      2640
     caagaaaaaa cacaagaagc tcagacgcga gttattgaat atcaacaaga acagacaaca      2700
     gttaacaatc aactcgcaac agttactagt caattgacag aactgaatag ccaaattaca      2760
     gccattcaag ccgatttgaa gcaattagaa gagaacttag gagaagagaa aaagaaacgg      2820
     gatataacgg aaacaggagt gcgagccctc ctcctgcgac aacaaaaatt acaatgggaa      2880
     ttagagaaac tgcaagaaac ccaagaaaaa cggagagaag acctaaccgc attacaaact      2940
     caatttcggg atttaggcgc agaattaccc aatcccctgc cagaagttcc tgctcaagtt      3000
     gaattagaag aattgcaaca agaattgaga agtctagcca aacgcttaca gacaatggaa      3060
     cccgtcaata tgctggcatt ggaagactat gataaagtcc aaaatcgtct ccaggaactg      3120
     actgataagt tacacaccct agaagcagaa cggacagaac tattattaag aattgaaaac      3180
     tttaccagct tacgtcaaat cgcctttaaa gaagccttcg acgcagtaaa cgaaaacttc      3240
     caatcaattt tcgccaccct ttccgacggt gacggatacc tccaactgga taatatagaa      3300
     gatcccttta acagcggttt aaacctagtc gcacacccca aaggtaaacc agtacagcgt      3360
     cttgcttcca tgtctggtgg agaaaaatcc ttaacagcat taagttttat tttttcccta      3420
     caacgctatc gtcccagccc attttacgcc tttgacgaag ttgatatgtt tttagatgga      3480
     gcaaacgtcg aacgattagc taaaatgatt aaacaacagg cacaacaagc acagtttatt      3540
     gttgtgagtt tacgtcgtcc gatgatacaa tcggccgagc gcacaattgg cgttactcaa      3600
     gccagaggag cctataccca agtattgggt attaagttac aatcctctag ttaa            3654
//

If you have problems or comments...

PBIL Back to PBIL home page