(data stored in SCRATCH zone)

EMBL: CP002059.PE531

CP002059.PE531       Location/Qualifiers
FT   CDS_pept        complement(800637..800894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0756"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63199"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63199.1"
FT                   /translation="MSVAGVAKITLLPHVMKSCCSPLNSTALIYSIGVTRATDGLQPLI
FT                   YNTSNGALFFDTDGNCADLSVRIPTLSTQQFLSNSDITVI"
     atgtctgtgg ctggcgtagc taaaattaca cttctgccac acgtcatgaa atcgtgttgc        60
     tcccctttaa actctacagc tttaatttac agtataggtg tgactagagc tactgatggt       120
     ttacaaccat tgatttacaa taccagcaac ggtgcattat tctttgatac tgatggtaat       180
     tgcgcagatt taagcgttcg tattcccact ctaagtactc agcagtttct cagtaatagt       240
     gacattactg taatttaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page