(data stored in SCRATCH zone)

EMBL: CP002059.PE532

CP002059.PE532       Location/Qualifiers
FT   CDS_pept        806735..807094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0763"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F0870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63200"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H3"
FT                   /inference="similar to AA sequence:KEGG:Npun_F0870"
FT                   /protein_id="ADI63200.1"
FT                   /translation="MFRFIENLIGGILGFITGLFGNKDGYYLELKEEVAETKPVAAKPA
FT                   VAPAAKAEPAKVAKASVKAEPAKAIKAEPAKPVAPTETTFAPKYLIPSSSNDRRRPGAN
FT                   MNTYMDMARQVKVPG"
     atgttcaggt ttatcgaaaa tttaatcggt gggattttag gtttcattac tgggctattt        60
     ggcaataaag atggctacta cttggaacta aaggaagaag ttgctgaaac caaaccagta       120
     gcagctaaac cagcagtagc cccagcagcg aaagcagaac ctgctaaagt agctaaggca       180
     tcagtaaaag cagaacccgc taaagcaatc aaagcagaac ctgctaaacc agtagcacca       240
     actgaaacta cctttgcacc taagtatttg attccttcat cttctaacga tcgtcgtcgt       300
     cccggtgcga acatgaacac ttatatggat atggcgcgtc aagtgaaagt tcctggttaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page