(data stored in SCRATCH zone)

EMBL: CP002059.PE535

CP002059.PE535       Location/Qualifiers
FT   CDS_pept        810902..811399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0767"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F2853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63203"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H6"
FT                   /inference="similar to AA sequence:KEGG:Npun_F2853"
FT                   /protein_id="ADI63203.1"
FT                   /translation="MINKPMQLLLTGVIISVGLSPLLAEIKPPVSYSQIAAMVEALRLA
FT                   APQTKKPNSGYYSAWQVKPETLKVWSKNCLKKELTPTQFETDPKTARQIISCIVNRELT
FT                   NQLKATNNNEIAAVRGAACWWMTGLYTGCDKGFTGDYVQKVVRFYQQEKAKPKSVNSPS
FT                   TR"
     atgattaaca aaccaatgca actgctactt accggagtta ttatcagtgt aggactatcc        60
     ccattattgg ctgaaatcaa accacctgtt tcttatagcc aaattgcagc aatggtagaa       120
     gctttgcgac tagctgcacc ccaaacaaaa aagccaaaca gcggatatta cagcgcatgg       180
     caagttaaac cagaaacttt gaaggtttgg tcaaaaaatt gcctgaaaaa agaactcaca       240
     ccaactcagt ttgaaaccga tcccaaaaca gcacgtcaaa ttatctcttg tatcgtcaac       300
     cgcgagttaa ctaaccagtt aaaggctaca aataataatg aaattgctgc tgtccgtggt       360
     gcggcttgtt ggtggatgac aggactttat acaggttgtg ataaaggttt tactggtgat       420
     tatgtgcaga aagttgtccg tttttatcaa caagaaaagg caaaaccaaa aagtgtaaat       480
     tctccttcaa ctagataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page