(data stored in SCRATCH zone)

EMBL: CP002059.PE550

CP002059.PE550       Location/Qualifiers
FT   CDS_pept        839748..839939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63218"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63218.1"
FT                   /translation="MFQSLLITGLALLLAWKGFAITGQFLAVLAGNIGFQALICWDGLR
FT                   RYQHVFSAIKDHKAQIPI"
     atgtttcaaa gcttattaat caccgggtta gcactgttgc tggcatggaa gggatttgct        60
     attactggac aattcttagc tgtacttgct ggcaatattg ggtttcaggc tttgatatgt       120
     tgggatgggt tgcgtcgtta tcaacatgtt ttttcagcaa ttaaagatca taaagcccag       180
     attccgattt aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page