(data stored in SCRATCH zone)

EMBL: CP002059.PE551

CP002059.PE551       Location/Qualifiers
FT   CDS_pept        complement(841190..841771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0791"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: ava:Ava_4111 PBP
FT                   family phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63219"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J2"
FT                   /inference="protein motif:PFAM:PF01161"
FT                   /protein_id="ADI63219.1"
FT                   /translation="MPQRRGFLNQSFAIFGLVGLWLISSCSLTGNRSESKQEVKTMKLT
FT                   SSAFINNGLIPAKYTCDGADISPPLSWDEIPSETQSLALIVDDPDALARNFVHWVIYDI
FT                   TPTVNQLPEKIIGSKTIPSGGVQGKNDFGKLGYGGLCPPSGIHRYFFQLYALDQKLSLG
FT                   TGASKSQMISAMEGHILEKAELIGRYQRQR"
     atgccccaaa gacgaggttt tctcaatcaa agcttcgcta tatttggatt agtaggatta        60
     tggctgatta gtagttgtag tcttactggt aatcgcagtg aatctaaaca ggaggtgaaa       120
     accatgaaat taacgagtag tgcctttata aataatggct taattcctgc caaatatacc       180
     tgtgatggtg ctgatatttc cccaccctta agttgggatg aaattccatc ggaaacgcaa       240
     agtttagcat taattgttga tgatccagat gcactagcaa ggaattttgt acattgggta       300
     atttatgata ttacccccac agttaatcaa ctaccagaaa aaataattgg tagtaaaact       360
     attcctagtg gtggtgtaca gggtaaaaat gattttggca agttgggtta tggtggtctt       420
     tgtcccccta gtggaatcca tcgctatttt ttccaacttt atgctttaga tcaaaaattg       480
     agtttaggaa ctggtgctag taaaagccaa atgataagcg caatggaagg ccatattttg       540
     gaaaaagcag aattaattgg ccgctaccaa cgccagcgtt aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page