(data stored in SCRATCH zone)

EMBL: CP002059.PE558

CP002059.PE558       Location/Qualifiers
FT   CDS_pept        846691..848037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0798"
FT                   /product="FeS assembly protein SufD"
FT                   /note="KEGG: npu:Npun_F4824 FeS assembly protein SufD;
FT                   TIGRFAM: FeS assembly protein SufD; PFAM: SufBD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63226"
FT                   /db_xref="GOA:D7E1J9"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J9"
FT                   /inference="protein motif:TFAM:TIGR01981"
FT                   /protein_id="ADI63226.1"
FT                   /translation="MTIQVSPSSISDSLLNRDAFLNGLLNQVTTSATTGWLQQLRDSAV
FT                   KWVRHSVIPNTRNEEWRFTDLSLLKEVEFNSVDIKTLEKFQETALDVEIFSEVSHCLVF
FT                   VNGIFAPNLSAITNLPPGLKIGNLDILPDAVAQEYLAQSEGTRDVFTTLNTAGLNDVAV
FT                   VWVGKNVVVQNPIYLLFISVAGESAIISQPRCLVVAESNSQVSLIEEYTNRRGAEKAED
FT                   EVYFANSVTEIWVNENAQVSHTRVVMQGEAAFHIGKTAVTQAQYSRYSCNAVTVGGKIS
FT                   RHNLEILQTGEQTETTLNGLTVIAEKQLADTHSVLFLNHPHGVSKHLHKCIIGDRAHGV
FT                   FNGKIFVPKHAQLTDAYQLNRNLLLSSKARVDTKPQLEITADNVKCSHGATVSQLEDDE
FT                   IFYLQSRGIDRNNARKLLVNAFASEIINFIPVSPLREKLLKTVVSLTHK"
     atgactattc aagtttctcc cagttctatt tctgattctt tgttaaatag agatgctttt        60
     ttaaatgggt tattaaatca ggtaactaca tctgcaacaa ctggttggtt acaacaactg       120
     cgtgacagtg ctgttaaatg ggtacgtcat tctgttattc ccaacacccg caatgaagaa       180
     tggcgtttta ctgatttatc tcttttaaaa gaggttgaat ttaatagtgt agatattaag       240
     actttagaga agtttcagga aacagcttta gatgttgaga ttttctctga agtttctcat       300
     tgcttagtat ttgtaaatgg tatttttgcc cctaatttat ctgcaattac taatttgcct       360
     cctgggctaa aaattggtaa tttggatatt ttacctgatg cagttgcaca ggaatattta       420
     gctcagtctg agggtacaag ggacgttttt actactctga atactgctgg tttaaatgat       480
     gttgcagtgg tatgggttgg taaaaatgtg gtggttcaaa atcccattta tctgttattt       540
     atttctgttg ctggtgagtc tgccattatt tctcagcctc gttgtttagt ggtagctgaa       600
     agtaactctc aggtgagttt aattgaagaa tatacgaacc gcagaggcgc agagaaggca       660
     gaggatgagg tttactttgc taatagtgtt acggaaatct gggtaaatga aaatgctcag       720
     gtgagccata ctagagttgt gatgcaaggt gaagcggctt tccatattgg taaaactgct       780
     gtgactcagg cacaatatag tcgttatagt tgtaatgctg tgactgtcgg tggaaaaata       840
     tcacgtcaca atttggagat tttgcaaact ggtgagcaaa cagaaacaac gctgaatggt       900
     ttaacagtta ttgctgagaa acagttagct gatactcaca gtgtgctatt tttaaatcat       960
     cctcatggtg tgagtaaaca tttacataag tgcattatag gtgatcgcgc tcatggtgta      1020
     tttaatggca agattttcgt ccccaaacac gcacagttaa ctgatgcata ccagctaaac      1080
     cgcaatttat tgttatcatc caaagcgcga gttgatacca aaccccaact ggaaatcact      1140
     gctgataatg ttaaatgctc tcatggtgct actgtcagtc agttggagga tgatgaaatt      1200
     ttctatctgc aaagtcgtgg tattgatcga aataatgcac gtaagttatt agttaatgct      1260
     ttcgcttcgg aaattattaa ctttatacct gttagtcctt tgcgagagaa gctattgaag      1320
     acagtagtaa gtctcacaca taagtaa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page