(data stored in SCRATCH zone)

EMBL: CP002059.PE581

CP002059.PE581       Location/Qualifiers
FT   CDS_pept        873809..874531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0826"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63249"
FT                   /db_xref="InterPro:IPR030917"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M2"
FT                   /inference="similar to AA sequence:KEGG:Npun_F0457"
FT                   /protein_id="ADI63249.1"
FT                   /translation="MISLSKIFQEKQWSQVAVLILLLLLLTVGAVPGYLTGKWAWQQPP
FT                   PVNKLQELKNIRKVGLNIPGWQTVQQSESQIGEHQWSLQILKQQYPANEAILLLLPQNG
FT                   PRDQPEVEWIDISGWGKSTWGKWDVAQYRTAEFTFKQPSTQQLNTTIKVKSRFFRATTQ
FT                   KQTFAVLQWYAMPNGGTSSLVDWFLSDQLAQWQKKRVPWVAVSILMPMESFGEAETSCS
FT                   KLQSLGEKVQSELMSIAL"
     atgatttcct tatccaaaat tttccaggaa aagcaatgga gtcaggtagc cgtgttgatt        60
     ttactgctac tgttgttaac agtgggggca gttcctggat acctaacagg aaaatgggcg       120
     tggcagcagc caccgccagt taataaactc caggaattga aaaatattcg caaagtagga       180
     ttaaatattc ctggttggca aactgttcaa cagtcagaat cacaaattgg cgaacatcaa       240
     tggtctttgc agatactcaa acaacaatac ccagcaaatg aagctatact gctgctgcta       300
     ccacaaaatg gtccgagaga tcaaccagaa gtagagtgga tagatattag tggttggggg       360
     aaatcaactt ggggaaagtg ggatgtggct caatatcgta ctgctgaatt tactttcaaa       420
     cagccctcca ctcaacagtt gaatactact ataaaagtca agtcaagatt ttttcgggct       480
     acaacacaaa aacaaacttt tgctgtttta caatggtacg ccatgccaaa tggtggaacc       540
     tcatcacttg tcgactggtt tctatcagac caattagcac agtggcaaaa aaagcgtgtg       600
     ccttgggtgg ctgtgagtat tttaatgcca atggagtctt ttggagaagc agaaacatct       660
     tgttcaaagc ttcagtcgtt gggtgaaaaa gtacaatctg aattaatgtc aatagcttta       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page