(data stored in SCRATCH zone)

EMBL: CP002059.PE582

CP002059.PE582       Location/Qualifiers
FT   CDS_pept        874559..875929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0827"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; Soluble ligand
FT                   binding domain; KEGG: npu:Npun_F0458 polysaccharide export
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63250"
FT                   /db_xref="GOA:D7E1M3"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M3"
FT                   /inference="protein motif:PFAM:PF02563"
FT                   /protein_id="ADI63250.1"
FT                   /translation="MFIEPSSHKCAFNALFFVTLHVSVGLITSIQPILAQPSPSVEPSS
FT                   VEFTTPAATSEEISPSTKEESSPQFNRYFLDTGDTLNVIVQRPPGLYRLGIGDSISVSV
FT                   QRFPDLSFQAAINPEGNIVVPLLGVISLQGLSLKEAEAKIRSGLNRYVIDPIVLLSLSG
FT                   ERPNLSFSAPIGQDGNIIIPQVGKLFVKGLSLEEVQENIRLALSRITTDTVVTSLSQIR
FT                   PVQVTITGEVSRPGIYAAGVVIPRITDILPLAGGSTVTADLRQVQIRRKLSDGSTVSQN
FT                   VDLYASLQSGGSPPNLRLQDGDAIIIPRREVGTDDGYDRKLVARSTLAVPQIKVRILNY
FT                   AAGGIVTQSLPNGSTFIDVLGGVNLNTANLRDIALVRFDPEKGKAVTQRLDGKKALAGD
FT                   ASQNLALQDNDVILVGRNLIGKLQNLFTTITQPFFNVQSFLQFFQTFGNGFLGGGSN"
     atgtttatag agcctagttc tcacaaatgt gcatttaacg cgctgttttt tgtcactctt        60
     catgtaagtg ttgggttgat aacatctatt caacctattt tagcgcagcc ttcaccatct       120
     gtagaaccat cttcagtaga atttacaaca cctgcagcta cttctgagga aatatctccc       180
     agcacaaagg aagaaagttc accacaattc aaccgttatt tcttggatac aggagataca       240
     ctcaacgtta ttgttcagcg tcctcctgga ctataccgct taggaattgg agattctatc       300
     agtgtgtcag tgcaaagatt tccagattta agttttcaag cggcaattaa tccagaaggc       360
     aatattgtag tgcctctact gggagtgatc tctttacaag gcttgagttt gaaagaagca       420
     gaggcaaaaa ttcgctctgg tttaaatcgg tatgttattg atcccattgt gttgttatca       480
     ctatctggag aacgtccgaa tttaagtttc tcagccccta ttggtcaaga cggcaatata       540
     atcatcccgc aagtggggaa actgtttgta aaaggcttaa gtttggaaga agttcaagaa       600
     aatattcgct tggctttaag tcgtattact actgatactg tagtaacgtc tttatcacaa       660
     atacgtcccg ttcaagttac aattactggg gaagtatctc gtccaggaat ttatgctgct       720
     ggtgtggtaa tccctcgcat tactgatatt ttaccattag ctggtggttc aactgtgaca       780
     gcagacctac gacaagtgca aatacgtcgt aagctcagtg atggttctac agtttcacaa       840
     aatgttgact tatacgcctc attgcaaagt ggtggttcac cgcctaattt gcgcttacaa       900
     gatggggatg caatcattat cccacgtcga gaagttggta cagatgatgg ttatgatcgc       960
     aaattagtgg cacgttcgac tttggctgta cctcagatta aagtccgaat tttaaattat      1020
     gctgcgggag gaattgtgac tcaatcttta cctaatggca gtacatttat agatgttttg      1080
     ggaggtgtga accttaacac tgctaatctt cgggatattg ctttggttcg gtttgatccg      1140
     gaaaaaggca aagctgttac tcaaagactt gatgggaaaa aggcgctggc tggtgatgct      1200
     tctcaaaatt tagcactgca agataatgat gtaattcttg ttggtcgcaa cttaattggc      1260
     aaacttcaaa atttatttac taccattacc caaccatttt ttaatgtgca gtcatttttg      1320
     caattctttc aaacctttgg taacgggttt ctcggtggtg gttcaaatta a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page