(data stored in SCRATCH zone)

EMBL: CP002059.PE592

CP002059.PE592       Location/Qualifiers
FT   CDS_pept        891246..892889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0840"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein central
FT                   region; KEGG: ava:Ava_3533 acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0840"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63260"
FT                   /db_xref="GOA:D7E1N3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N3"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADI63260.1"
FT                   /translation="MNTADLLVQCLENEGVQYVFGLPGEENLHVLEALKNSSIQFITTR
FT                   HEQGAAFMADVYGRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRM
FT                   HIESHQYLDLVAMFAPVTKWNKQIVRPSITPEVVRKAFKRSQTEKPGAVHIDLPENIAA
FT                   MPVEGKPLHKDNSEKTYAAFASIRAAAAIISQAVNPIILVGNGAIRAQASDAVTQFTTQ
FT                   INIPVVNTFMGKGVIPYTHPLALYSVGLQQRDFITCGFDNTDLVIAIGYDLIEFSPKEW
FT                   NPDGKIPIIHIAAISAEIDSSYIPKVEVIGDISDSVNEILKLADRQGKPNPYAISLRSN
FT                   IRADYEQYAHDDGFPIKPQRLIYDLRQVMGPDDIVISDVGAHKMWIARHYHCHSPNTCI
FT                   ISNGFAAMGIAIPGALAAKLVYPDRKVVAATGDGGFMMNCQELETALRVGTPFVTLIFN
FT                   DGGYGLIEWKQENQFGKGNSCFVHFGNPNFVKLAESIGLKGYRVESATDLIPVVKEALI
FT                   QDVPAVIDCPVDYRENRRFSQKAGELNCDI"
     atgaatacgg cagatttgtt agtacagtgt ttagaaaatg aaggagtgca atatgttttt        60
     ggactgccag gtgaggaaaa tttgcacgtt ttagaagctt taaaaaactc atccattcaa       120
     tttattacta ctcgtcacga acagggtgca gctttcatgg cggatgttta tgggaggtta       180
     actggtaaag ccggagtctg tctttccact cttggtcctg gtgctactaa tttaatgact       240
     ggggttgcag atgctaacct tgatggtgca ccattagtag caattaccgg acaggtggga       300
     acagatagaa tgcatattga atcccatcaa tatttagatt tagtggctat gtttgcgcca       360
     gttactaagt ggaataagca gatagttaga ccgagtatta caccagaagt tgtgagaaaa       420
     gcattcaagc gctcgcaaac tgaaaaacct ggtgcagtcc acatagattt acccgaaaat       480
     attgctgcta tgcccgtaga aggcaaacct ttacataagg ataacagcga aaaaacctat       540
     gctgcttttg ctagtattcg cgctgctgct gccataattt ctcaagcagt taatcccatt       600
     atcttagtgg gaaatggggc gattcgcgct caagctagtg atgcggtgac gcaattcacc       660
     acccaaataa atattccagt cgttaatact ttcatgggta aaggcgtaat tccctacact       720
     catcctttag cactttattc tgtaggatta caacaaagag atttcattac ttgtggtttt       780
     gataataccg atttagtaat tgcaattggc tatgatttaa ttgaattttc tcccaaagaa       840
     tggaatcctg acggcaaaat tcctattatc catattgctg ctatttcagc agaaattgat       900
     agtagttaca ttcctaaagt cgaagttatt ggggatattt ctgattcagt taatgaaata       960
     ttaaaattag cagacagaca aggaaaaccc aatccctatg ccatcagttt acgttctaat      1020
     attcgcgctg attacgaaca atatgcccat gatgatggct tcccaataaa accgcaaaga      1080
     ttaatttatg atttgcggca agtgatggga ccagatgata ttgtcatttc tgatgtaggt      1140
     gcacataaaa tgtggattgc tagacattat cattgtcata gtcctaatac gtgcattatt      1200
     tccaatggat ttgcagcaat gggaattgcc attcctgggg ctttagctgc taaacttgtc      1260
     tatccagatc gtaaagttgt agcagctaca ggcgatggtg gctttatgat gaactgtcaa      1320
     gaattagaaa cagctttgcg tgttggtaca ccttttgtta ccttaatttt caatgacggt      1380
     ggctatggtt taattgaatg gaaacaagaa aatcaatttg gtaaaggtaa ttcatgtttt      1440
     gtgcattttg gtaatcctaa ttttgtcaaa ttagccgaaa gtataggatt aaaaggttac      1500
     agggttgaat cagcaactga tttaattcct gtcgtcaaag aagccctaat tcaagatgtt      1560
     cctgcggtaa tagattgtcc tgtagattat cgagaaaacc gccgttttag tcaaaaagct      1620
     ggggagttaa attgtgatat ttaa                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page