(data stored in SCRATCH zone)

EMBL: CP002059.PE597

CP002059.PE597       Location/Qualifiers
FT   CDS_pept        complement(897805..899418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0846"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   ava:Ava_3962 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0846"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63265"
FT                   /db_xref="GOA:D7E1N8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N8"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADI63265.1"
FT                   /translation="MRLKFLAIAVSMGVTVISVQKTTARTPLLPYLQTPSNLSNSTGNQ
FT                   TVSEWIYLDGRPLFQIAASKNDVSERLQSIQQNLQEISQDYFQSKAPEFKIQIRTTKDL
FT                   PVIYINGKYLMTINSQDAKLRQLKALTLANEIADNLQDNLEVSKKERQTSSLISQCKIA
FT                   GAIALVMILSSSLIYRYQRRSQKDDVEPICPDAETGQPITTQLNQQEHQHLAEVKNRLF
FT                   QLSQTGIWGGGSFVILGLFPYTRALQMALLAVAQIPLKVGIVVLGTYVAVRFSYALIDK
FT                   FTTTLISGGFLLNSETSERMELRVSTFSGVTKSITTLICMGVGILSILISLGIDIVPLL
FT                   AGAGLIGVAVSLASQNLIKDAINGFLIIIEDQYALGDVINVGNVGGLVENLNLRMTQVR
FT                   DAEGRLITIPNSEIKVVANLSSRWSRADLTIPVSYQANIDEALKLIEDVALNMNQEPKW
FT                   KREIIEKPSILGIDNFSERGMMIRVWIKTQPLKQWEVAREYRRRLKIALDQVGISIPIP
FT                   QQTILVNHPQLLNSARNNSD"
     gtgcgtttaa aatttttggc aatcgcagtt tcaatgggtg ttaccgttat ctctgttcaa        60
     aaaactacag cccggactcc tcttttaccc tacttgcaaa ctcctagtaa tctaagtaat       120
     tctaccggaa atcaaactgt ttccgaatgg atttatttag atggtcgccc attatttcaa       180
     atcgctgcat caaaaaacga tgtttccgag cggttacaaa gtatccaaca gaatttacag       240
     gaaattagcc aagattactt tcaatcaaaa gcaccagaat ttaagataca aatccgaaca       300
     accaaagatt tgccagtaat ttatatcaat ggcaaatatc tgatgaccat caattctcaa       360
     gatgctaaat tacgtcaatt aaaggcgttg acattggcta atgaaatcgc cgataatttg       420
     caggataacc tggaagtttc taagaaagaa cgccaaactt catctttaat tagccaatgt       480
     aaaatagctg gtgctattgc tttggtaatg attttgtcaa gttcattaat atatcgttat       540
     caacgccgtt ctcaaaaaga tgatgtagaa ccaatttgtc cagatgcgga aacaggtcaa       600
     ccgattacaa cccaactaaa tcaacaggaa catcaacatt tagcagaagt taaaaaccgc       660
     ctatttcaat taagtcaaac aggcatttgg ggaggtggaa gttttgtaat cttgggtcta       720
     tttccctaca ccagagcatt acaaatggca cttcttgcag ttgcccaaat tcctctaaaa       780
     gtaggtattg tggtattagg aacttatgta gcggttcgtt ttagttatgc cctgattgat       840
     aaatttacca caactctaat tagcggtggt tttttattaa attcagaaac ttcagaacgg       900
     atggagttaa gagtttccac attttcagga gtaaccaaaa gcattactac cctcatttgc       960
     atgggagtag gaattttatc cattttgatt tcattaggta tagatatagt tcctttgtta      1020
     gcaggtgctg gtttaattgg tgtagctgta tctctcgctt ctcaaaactt aattaaagat      1080
     gccattaatg gctttttgat tatcatcgaa gatcaatatg cccttggtga tgtgattaat      1140
     gtgggaaacg taggaggttt agtcgagaat ctcaatttac gcatgactca agtacgggat      1200
     gcagaaggac gtttaattac aattcccaac agtgaaatca aagtagttgc caatctttct      1260
     agtcgatggt cacgggcaga tttaactatt ccggtttcat atcaagccaa tattgatgag      1320
     gctttgaagt taattgaaga tgtggctttg aacatgaatc aagaaccaaa atggaagcga      1380
     gaaatcattg aaaaaccgag tattttagga attgataatt ttagcgagcg cggtatgatg      1440
     attcgtgtct ggattaaaac acaacccctc aaacaatggg aagtagcgag agaatatcgt      1500
     cgtcgtctaa aaattgcctt agatcaagtt ggaatttcca ttcccatacc tcaacaaacc      1560
     attttagtga atcatcctca actgttgaat tctgccagaa ataattcaga ttaa            1614
//

If you have problems or comments...

PBIL Back to PBIL home page