(data stored in SCRATCH zone)

EMBL: CP002059.PE6

CP002059.PE6         Location/Qualifiers
FT   CDS_pept        8358..8510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62674"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62674.1"
FT                   /translation="MILNVRRASLKEIVKNLRDTIAYGTLPVHAVSQRDTLGYHYDISP
FT                   SLTRL"
     atgattctga acgttcgccg agcgtctctg aaagagatag tgaagaatct ccgagatact        60
     atagcctacg gcacgctccc tgttcacgca gtgtcccaaa gggatacgct gggctatcac       120
     tatgacataa gtccaagtct cacccgtttg tag                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page