(data stored in SCRATCH zone)

EMBL: CP002059.PE69

CP002059.PE69        Location/Qualifiers
FT   CDS_pept        74938..75465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R6559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62737"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC9"
FT                   /inference="similar to AA sequence:KEGG:Npun_R6559"
FT                   /protein_id="ADI62737.1"
FT                   /translation="MQPIQSRWIRFLSGLMVLTVLSVAKANDPGLCFMTTSSGSINLGE
FT                   ICKVIQTTDTFFRVPMKGRQAKNPIIYVKFNGGQVFEMVFDTGASGILITQEIAKKSNI
FT                   KPAGKSRFTIADGSVVEFQTITILSVSGGSVVVNNAQISIAPKAEIGLLGHGFFQNYDV
FT                   RILKKQIEFHKR"
     atgcaaccta ttcaaagcag atggattagg tttttatctg ggttaatggt tttaacagtg        60
     ctatcggtag caaaagctaa tgatccgggt ctttgtttta tgacgacatc atcaggtagt       120
     atcaatttgg gggaaatatg caaggttata caaaccacgg atactttttt tcgcgtccct       180
     atgaagggtc gtcaggcaaa gaatccgatt atatatgtta agtttaatgg tggtcaagtt       240
     tttgagatgg tttttgatac tggtgcaagt ggtatcctga ttactcaaga aatcgcgaaa       300
     aagtcgaata tcaagcctgc gggaaaaagt cgattcacta ttgctgatgg tagtgtagta       360
     gaattccaaa ctataacaat tctttctgtc tctggtggga gtgttgttgt caataatgcc       420
     caaatttcta ttgcgcctaa agctgagatt ggtttacttg gtcatggttt ttttcagaat       480
     tatgatgtaa gaattctcaa aaaacagatt gaatttcata agcgttaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page