(data stored in SCRATCH zone)

EMBL: CP002059.PE86

CP002059.PE86        Location/Qualifiers
FT   CDS_pept        complement(93057..93284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62754"
FT                   /db_xref="InterPro:IPR021336"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK7"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4158"
FT                   /protein_id="ADI62754.1"
FT                   /translation="MIIHSTQGREIQMAPSRYSRLINFLQEDLAISAASLAVALRHREQ
FT                   DPGSLTMILWQYGLITLEQLEKIYDWLETA"
     atgataatac actctactca aggacgtgag atacaaatgg caccatcgag atattctcgt        60
     ttaattaatt ttctccaaga agatttagcg atttccgcgg cttctctggc tgtagcactg       120
     cgtcaccgag agcaagatcc tggttcttta accatgatcc tgtggcagta tggcttgatt       180
     actctagaac agttagaaaa aatttatgat tggctagaga cggcatag                    228
//

If you have problems or comments...

PBIL Back to PBIL home page