(data stored in SCRATCH zone)

EMBL: CP002059.PE92

CP002059.PE92        Location/Qualifiers
FT   CDS_pept        complement(99858..100796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0113"
FT                   /product="phosphoribulokinase/uridine kinase"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   ava:Ava_0169 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62760"
FT                   /db_xref="GOA:D7DVL3"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL3"
FT                   /inference="protein motif:PFAM:PF00485"
FT                   /protein_id="ADI62760.1"
FT                   /translation="MSCPIILGIVGDSAAGKTTLTRGIAQILGPENVTLICTDDYHRYD
FT                   RTERAKLGITALHPDCNHLDIMQQHLSLLRTGQPILKPVYSHQTGSFEAPKYIKPSKFV
FT                   IIEGLLGYSTRAARDAYDVKVYLAPPEKLRATWKVKRDTQKRGYTPEQVLEELEKREPD
FT                   SQQFIRPQRQWSDIVVSFYPPNENEDESNGHLNVRLVLRPTIPHPDFTEIIEAGNGDLE
FT                   SAVRLGLVRDMGKPVDVLEVDGHATLEQVNKIEHIMCSDMPYLKSICDREINPELGKIA
FT                   GTTGETLQSYPLALTQLIITYHMLKATQIYQ"
     atgagttgtc caatcattct tggtattgta ggtgacagtg cagccggaaa aactaccctg        60
     accaggggta ttgctcagat acttggcccg gagaatgtta cactcatctg tactgatgat       120
     taccaccgtt atgatcgcac agaacgcgcc aaattaggta ttacagccct tcatcctgac       180
     tgtaatcatt tagatattat gcagcagcat ctatcacttt tacgcacagg tcaaccaatt       240
     cttaaaccag tttatagcca ccaaacggga agctttgaag ctccaaagta tattaaacct       300
     agtaaatttg tcattattga gggcttactt ggttattcta cccgtgcagc ccgtgatgct       360
     tatgatgtta aagtttacct tgcaccaccg gaaaaactcc gcgctacgtg gaaagttaag       420
     cgagatacgc aaaaacgcgg ctatactcca gaacaggtat tggaagaatt agaaaaacgt       480
     gaaccagact cacaacagtt tatccgtccc cagcgtcaat ggtctgatat agtggtgagt       540
     ttctatcctc ccaacgaaaa tgaggatgaa agcaatggac atttaaatgt gcgcttggtg       600
     ttgcgtccaa caatccccca cccagatttt acagagatta ttgaagctgg taatggtgat       660
     ctagaatcag ccgtgcgttt gggactagtc cgagatatgg gtaaaccggt ggatgtgtta       720
     gaagttgatg gacacgctac tttggaacag gtgaataaga tagagcatat tatgtgttca       780
     gatatgcctt acttaaaaag tatatgtgat cgcgaaatta atcccgaact aggtaaaata       840
     gcaggtacaa cgggagagac tttgcaaagt tatccccttg cacttaccca attaatcatt       900
     acttatcata tgttgaaggc tacgcaaata tatcaataa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page