(data stored in SCRATCH zone)

EMBL: CP002105.PE10

CP002105.PE10        Location/Qualifiers
FT   CDS_pept        16502..17482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0010"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="COGs: COG0616 Periplasmic serine protease (ClpP
FT                   class); InterPro IPR002142:IPR004635; KEGG: tte:TTE0850
FT                   periplasmic serine protease (ClpP class); PFAM: peptidase
FT                   S49; SPTR: C6PKC5 Signal peptide peptidase SppA, 36K type;
FT                   TIGRFAM: signal peptide peptidase SppA, 36K type; PFAM:
FT                   Peptidase family S49; TIGRFAM: signal peptide peptidase
FT                   SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11562"
FT                   /db_xref="GOA:D9QSA6"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSA6"
FT                   /protein_id="ADL11562.1"
FT                   /translation="MGFSIKKMTVSILLSFLIILVILGGLGFLLINFLGNSDQAGVESI
FT                   AVINIHGPISVGGTQEVLSTSQTNASEVIKQINEAKDNKKIKALLLRVNSPGGSSAASD
FT                   EIYRELKKFKKTGKPVVISMGDIATSGGYYISAIADQIYANPSTITGSIGVIMQFKNLQ
FT                   DLYDKLGVDSITFKSGPYKDIGNPDRKLTAEEKELLQNMVDEVYQEFLTAVAEGRSMSK
FT                   SKVEKLADGRIYNGRKAKKLGLVDEMGTFYDAVKTTAKLAEMKADPNLIYYNRSSPLER
FT                   FFRSTTNLIKGVLLQQGLKINSNNPNELYYHLLQEEKVNNLELEY"
     atggggttta gtatcaaaaa aatgacagtt tcaattttat tgagtttttt aatcatttta        60
     gtaattttag gaggtttagg ttttttatta attaattttt taggaaacag tgaccaggct       120
     ggagttgaaa gtatagcagt tattaatatt catggtccta tttcagttgg aggaactcaa       180
     gaagttttaa gtacttcaca gactaatgcc agtgaagtta taaagcagat taatgaagct       240
     aaggataata aaaagattaa agccttgtta ttgcgagtaa atagtcctgg aggtagttca       300
     gctgcttcag atgaaatata tcgtgaacta aaaaagttta aaaagacagg taaaccagta       360
     gttatttcga tgggagatat agctacttct ggaggttatt atatttcagc tattgctgat       420
     caaatttatg ctaatccttc tacaattact ggaagtatag gggtgattat gcagtttaaa       480
     aatttacaag atctttatga taaattaggt gttgattcaa ttacttttaa aagcggccct       540
     tataaagata tcggtaatcc agatcgaaag ttaacagcag aagagaaaga attattacag       600
     aatatggttg atgaagttta tcaggaattt ttaactgcag ttgctgaagg aagaagtatg       660
     tctaaatcta aagtagagaa attggctgat ggtaggattt ataatggccg aaaggctaaa       720
     aagttaggat tagtagatga aatgggaact ttttatgatg cagtaaagac tactgctaaa       780
     ttagcagaga tgaaagcgga tcctaattta atttattata atcgttcttc gcctttagaa       840
     cgtttttttc gttccactac taatttaatt aaaggagtat tattacagca aggattaaag       900
     atcaattcaa ataaccctaa tgaattatat tatcacttat tacaagagga aaaggttaat       960
     aatctggaat tagagtatta a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page