(data stored in SCRATCH zone)

EMBL: CP002105.PE11

CP002105.PE11        Location/Qualifiers
FT   CDS_pept        17980..18225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0011"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167; KEGG: hor:Hore_02720 ferrous
FT                   iron transport protein FeoA; PFAM: FeoA family protein;
FT                   SPTR: B8D1F6 Ferrous iron transport protein FeoA; PFAM:
FT                   FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11563"
FT                   /db_xref="GOA:D9QSA7"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSA7"
FT                   /protein_id="ADL11563.1"
FT                   /translation="MKLTNIPIGKSGKVMRLTCQGQKRRRLLDLGLIPGTIVRAKQKSP
FT                   FGDPIAFEIRGATMALRSEETEAVIIEEVKKNKKVS"
     gtgaaattaa ccaatatacc aataggtaaa agtggtaaag taatgcgtct tacttgccaa        60
     ggacagaaaa gaagaagatt attagattta gggttgatcc cgggaactat agtaagggct       120
     aagcagaaga gcccattcgg tgatccaatt gcttttgaaa tcagaggagc tacaatggct       180
     ttgagaagtg aagaaacaga ggcagttatc atagaagaag tgaaaaaaaa taaaaaagtt       240
     agttaa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page