(data stored in SCRATCH zone)

EMBL: CP002105.PE12

CP002105.PE12        Location/Qualifiers
FT   CDS_pept        18241..19044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0012"
FT                   /product="GTP-binding protein HSR1-related protein"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterPro IPR002917:IPR011619:IPR006073; KEGG:
FT                   hor:Hore_02710 ferrous iron transport protein FeoB; PFAM:
FT                   GTP-binding protein HSR1-related; Ferrous iron transport
FT                   protein B domain protein; SPTR: B8D1F5 Ferrous iron
FT                   transport protein FeoB; PFAM: Ferrous iron transport
FT                   protein B; TIGRFAM: small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11564"
FT                   /db_xref="GOA:D9QSA8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSA8"
FT                   /protein_id="ADL11564.1"
FT                   /translation="MEPKADSDQISLLRESFNINFKRGNPVIALAGNPNTGKSTVFNGL
FT                   TGLKQDTGNWPGKTVTQAQGYYTYQNQDYILVDLPGTYSLLANSTDEQVARDFICFAQP
FT                   DATIVVVDATKLERNLNLVLQIMELTNNVVVCLNLMDEARRKNIEIDVEGLSQDLQIPI
FT                   IPTVAPKKIGLEKLKDKIADIVTGRIKVTPKQIKYSSQIEEAIEKILPDLEAILPDYIN
FT                   SRWVALQLIEGDNSILEAMQTYYPEQIVKEITANLQSEVKAGGAF"
     atggaaccaa aagctgattc ggatcaaatt agtctattgc gcgagtcatt caatattaat        60
     ttcaaaagag gaaatccggt tattgcttta gcaggaaatc ctaataccgg aaaaagtact       120
     gtttttaatg gcttgacagg attaaaacaa gataccggta actggcctgg taaaacggta       180
     acacaagcac aaggctatta tacttatcaa aatcaagatt atatattagt tgatttacca       240
     ggtacctatt ctttattagc taattctact gatgaacagg tagctagaga ttttatctgt       300
     tttgcacaac cagatgcaac tattgtagtt gttgatgcaa ctaaattaga acgaaatctt       360
     aacttagttc tacagataat ggaacttact aacaatgtag ttgtctgttt gaatttaatg       420
     gatgaagcaa gacgcaaaaa tattgagatt gatgtagaag gtttaagtca ggatttacag       480
     attcctataa ttcctactgt tgctccaaaa aagattggtt tagaaaagct taaagacaaa       540
     atagctgata ttgtaacagg aagaataaaa gtaactccaa aacaaattaa atactcttca       600
     caaatagaag aggcaataga aaagatttta ccagatttag aagctatttt acctgattat       660
     ataaattctc gttgggtggc tttacaacta attgaaggag ataatagcat tcttgaagca       720
     atgcagactt attatcctga acagattgta aaagaaatta cagctaactt acaaagcgag       780
     gtgaaggcag gtggagcttt ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page