(data stored in SCRATCH zone)

EMBL: CP002105.PE143

CP002105.PE143       Location/Qualifiers
FT   CDS_pept        160451..161182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0144"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro
FT                   IPR013123:IPR001537:IPR004441; KEGG: cdf:CD0055 putative
FT                   tRNA/rRNA methyltransferase; PFAM: tRNA/rRNA
FT                   methyltransferase (SpoU); RNA 2-O ribose methyltransferase
FT                   substrate binding; SPTR: Q18CE0 Putative tRNA/rRNA
FT                   methyltransferase; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 3; PFAM: SpoU rRNA Methylase family; RNA 2'-O
FT                   ribose methyltransferase substrate binding; TIGRFAM: rRNA
FT                   methylase, putative, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11695"
FT                   /db_xref="GOA:D9QTD1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTD1"
FT                   /protein_id="ADL11695.1"
FT                   /translation="MKKIEGRNPVMEALKSERRIDEILIYQNAEGVNELLKKAKAEGIK
FT                   LKRVAKEKLDNLADSYSHQGVIAFGEPIKYLSLDQLIDKAYNKTDDPLFILLDEIKDPH
FT                   NFGSILRTADAVGAQGVIIPKRRSVGLTSAVGKASAGAIEHIPVAQVTNLVRAMEELKE
FT                   NRFWIAGADMEAEGFCYQQDLTGPLGIVIGSEGAGMRRLVKERCDFLIKLPMKGRINSL
FT                   NAAVAGAVLMYEALRQRNYSD"
     atgaagaaaa tagaaggccg taatcctgtt atggaagcat tgaaatccga aagaagaata        60
     gatgagatat taatctatca gaatgctgaa ggggttaatg aattattaaa gaaagccaaa       120
     gcagaaggga ttaaactcaa acgagttgct aaagaaaagc ttgataactt agctgattct       180
     tattctcatc aaggagtaat tgcttttggt gaacctatta agtatttatc attggaccaa       240
     ttaattgata aggcatataa taagactgat gatccattat ttattctgtt ggatgagatt       300
     aaagatcccc ataatttcgg ttctattctg cggacagctg atgctgttgg agctcaggga       360
     gtaattattc ctaaacgtag aagtgttggt ctaacatcgg ctgtcggaaa ggcttcagca       420
     ggagctattg aacatatacc ggtagctcag gtaactaatt tagtccgggc catggaagaa       480
     ttaaaagaga atagattctg gattgcaggt gctgatatgg aggcagaagg cttctgttat       540
     caacaggatt tgacaggacc attggggatt gttatcggca gtgaaggagc tggaatgcgc       600
     aggttagtta aggaaagatg tgatttcttg attaaattac caatgaaagg tagaataaat       660
     tctttaaatg cagcagtagc aggggctgtt ttaatgtatg aagccttgcg gcagcgaaat       720
     tatagcgatt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page