(data stored in SCRATCH zone)

EMBL: CP002105.PE146

CP002105.PE146       Location/Qualifiers
FT   CDS_pept        163627..164823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0147"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="COGs: COG0050 GTPase - translation elongation
FT                   factors;
FT                   InterProIPR000795:IPR004161:IPR004160:IPR009001:IPR
FT                   009000:IPR004541:IPR005225; KEGG: hor:Hore_01150
FT                   translation elongation factor Tu; PFAM: protein synthesis
FT                   factor GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor Tu domain protein; SPTR: B8D0A8
FT                   Elongation factor Tu; TIGRFAM: translation elongation
FT                   factor Tu; small GTP-binding protein; PFAM: Elongation
FT                   factor Tu domain 2; Elongation factor Tu C-terminal domain;
FT                   Elongation factor Tu GTP binding domain; TIGRFAM: small
FT                   GTP-binding protein domain; translation elongation factor
FT                   TU"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11698"
FT                   /db_xref="GOA:D9QTD4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTD4"
FT                   /protein_id="ADL11698.1"
FT                   /translation="MAKEKFERDKPHMNIGTIGHVDHGKTTTTAAITKVLSKGEEGSAN
FT                   FEDIDNAPEEQERGITIATSHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGALLV
FT                   VSAADGPMPQTREHLLLARQVNVPNIVVFLNKADMVDDEELIELVEMEVRELLNEYDFN
FT                   GDEVPIIVGSGLKALECGCGDRDCEWCGQILELMDAIDEYLPEPERDTDKPFLLPVEDV
FT                   FTIKGRGTVATGRLERGKLHPGDEAELVGVKDTQETVVTGVEMFRKMLDEAVAGDNIGA
FT                   LLRGVDREEIERGQVLAEPGSITPHTEFEAEVYVLSKDEGGRHTPFFDGYRPQFYFRTT
FT                   DVTGDINLPDDVEMVMPGDNVEMGVKLITPIAMEEGLRFAIREGGKTVGAGVITEIIE"
     atggcaaaag aaaagtttga acgagataag ccgcatatga atattggaac tattggacat        60
     gttgaccacg gtaagacaac aacaactgct gcaattacta aggtgttatc caaaggagaa       120
     gagggttctg caaattttga ggatatcgac aacgcaccag aagagcagga acgcggaatt       180
     acaatcgcta cttctcatgt ggagtatgaa acagagaacc gtcactatgc tcacgtagac       240
     tgtccaggac atgctgacta tgttaagaat atgattactg gtgcagctca gatggatgga       300
     gcattattgg ttgtatctgc tgctgatgga ccgatgccgc agacaagaga gcacctacta       360
     ttggcccgtc aggtaaatgt accgaatatt gtagtcttct tgaacaaggc agatatggtt       420
     gatgacgaag aattaatcga attagtagag atggaagtaa gagaactact taatgaatat       480
     gactttaacg gtgatgaagt accaattatt gttggttccg gtcttaaagc attagaatgt       540
     ggttgtggag atagagactg tgaatggtgc ggacagattc tagaattgat ggatgctatt       600
     gatgagtatc tgcctgaacc agaaagagat acagacaagc cgttcttact accagtagag       660
     gatgtcttta caatcaaagg acgcggaaca gttgctacag ggagattaga acgaggaaag       720
     ctacatcctg gagatgaagc agagttagta ggagttaagg atacacagga gacagtagta       780
     accggagtag agatgttccg taagatgtta gatgaagcag tagctggaga taatattggt       840
     gccttactga gaggtgttga tagagaagag atcgagagag gccaggttct agctgagccg       900
     ggatcaatta caccacatac tgaatttgaa gcagaggttt atgtactaag taaagacgaa       960
     ggcggaagac atacaccatt ctttgatgga tatagaccac agttttattt ccgaactaca      1020
     gacgtgacag gagatatcaa cctaccagat gatgtagaga tggtaatgcc tggagataat      1080
     gtagagatgg gagttaaatt gattacaccg atagctatgg aagaaggtct gcgctttgca      1140
     attcgcgaag gcggtaagac tgtaggagcc ggtgtaatta cagagattat tgaataa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page