(data stored in SCRATCH zone)

EMBL: CP002105.PE15

CP002105.PE15        Location/Qualifiers
FT   CDS_pept        complement(21163..21705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11567"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSB1"
FT                   /protein_id="ADL11567.1"
FT                   /translation="MIFKVLKKVFNRSNVISEIEIAEELIDLLSNENQELMEELKSTKK
FT                   SKQEIALLLTSIYLFNYKLTIKTNNLSMRSKKIEDIFYHFSFLIAEKNINFYNLNQQTN
FT                   TLVDKAKAKADRLMKIYQSSSSNKKINRIQEVVKALYYDFSAENQEHGPQEMKLLLDLV
FT                   IQNITLIQDYLIKVSKI"
     atgatattta aagtattaaa aaaagtattt aatagaagta atgttatttc ggagattgaa        60
     atagcagaag aattgattga tttactttcc aatgaaaacc aagagttaat ggaagaatta       120
     aagagtacga aaaaatcaaa acaagaaata gccttattat taacttctat ttatctattt       180
     aattataagt taactataaa aactaataat ctaagtatgc gttccaaaaa aatagaagat       240
     attttttatc atttttcttt tttaattgca gaaaagaata ttaattttta taatttaaat       300
     caacaaacaa atacgttggt agataaagca aaagctaaag cggatagatt aatgaaaatt       360
     tatcagagta gttcttcaaa taaaaaaata aatcggattc aagaagtggt aaaagcatta       420
     tattatgatt ttagtgcaga aaatcaagaa catggtccac aagaaatgaa attattgtta       480
     gatttagtta tccaaaatat aactttaatt caagactatt taattaaagt atcaaagata       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page