(data stored in SCRATCH zone)

EMBL: CP002105.PE153

CP002105.PE153       Location/Qualifiers
FT   CDS_pept        167928..168302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0154"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="COGs: COG0222 Ribosomal protein L7/L12; InterPro
FT                   IPR013823:IPR014719:IPR008932:IPR000206; KEGG:
FT                   hor:Hore_01080 ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; SPTR: B8D0B5 50S ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12 C-terminal domain; TIGRFAM: ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11705"
FT                   /db_xref="GOA:D9QTE1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTE1"
FT                   /protein_id="ADL11705.1"
FT                   /translation="MDKEEIMEAIENMTVLELAELVEELEEKFDVSAAAPVAMAGAPAA
FT                   GGDAGDEEEQTAFDVEITSGGDKKIKVIKAVREVTDLGLKDAKALVDEAPNTVKEGLEK
FT                   EEAEEIKEQLEEAGATVELK"
     atggataaag aagaaattat ggaagctatt gagaatatga ctgttcttga attagctgaa        60
     ttagttgaag aattagaaga aaagtttgat gtttctgctg ctgcaccagt agcaatggca       120
     ggagctcctg ctgccggtgg tgatgctggt gatgaagaag aacagacagc ttttgatgta       180
     gagattactt ctggtggaga taagaagatt aaggtaatca aagctgtacg agaagtaact       240
     gatttaggcc ttaaagatgc taaggcttta gttgatgaag cacctaacac tgttaaagaa       300
     ggtttagaaa aggaagaagc tgaagagatt aaggaacagc ttgaagaagc tggtgctact       360
     gtagaactta aataa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page